Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent (238)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYFFLRTLSALEI      1 - 70
GYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYDRYAAICEPLRYPLLLSHRVC     71 - 140
LQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPF    141 - 210
GLILGSYGRILVTIFRIPSVAGRRKAFSTCSSHLIMVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVV    211 - 280
TPILNPIIYSLRNTEVKAALKRTIQKTVPMEI                                          281 - 312
//

Text Mined References (10)

PMID Year Title