Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.20

Knowledge Summary

Patent (196)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.4e-03

AA Sequence

ITPMLNPIIYGLRNNEVKGAVKRTITQKVLQKLDVF                                      281 - 316

Text Mined References (3)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.