Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.05
PubTator Score 1.05

Knowledge Summary

Patent (210)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Atopic dermatitis 915 3.106 1.6

AA Sequence

MKRQNQSCVVEFILLGFSNFPELQVQLFGVFLVIYVVTLMGNAIITVIISLNQSLHVPMYLFLLNLSVVE      1 - 70
VSFSAVITPEMLVVLSTEKTMISFVGCFAQMYFILLFGGTECFLLGAMAYDRFAAICHPLNYPVIMNRGV     71 - 140
FMKLVIFSWISGIMVATVQTTWVFSFPFCGPNEINHLFCETPPVLELVCADTFLFEIYAFTGTILIVMVP    141 - 210
FLLILLSYIRVLFAILKMPSTTGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPETKKLISLAYTL    211 - 280
LTPLLNPLIYSLRNSEMKRTLIKLWRRKVILHTF                                        281 - 314
//

Text Mined References (7)

PMID Year Title