Property Summary

NCBI Gene PubMed Count 468
PubMed Score 1716.83
PubTator Score 1271.57

Knowledge Summary

Patent (90,709)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 1.0
Disease Target Count Z-score Confidence
Alcohol dependence 107 5.716 2.9
Opiate dependence 29 5.159 2.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.300 7.3e-03
atypical teratoid / rhabdoid tumor 1.500 1.2e-03
glioblastoma 1.300 1.1e-03
medulloblastoma, large-cell 1.700 1.0e-05
osteosarcoma 1.023 1.4e-05
ovarian cancer 1.900 1.7e-10

Gene RIF (503)

AA Sequence

MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITA      1 - 70
ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTI     71 - 140
LCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATT    141 - 210
KYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRI    211 - 280
TRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFR    281 - 350
EFCIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP                        351 - 400
//

Text Mined References (478)

PMID Year Title