Property Summary

NCBI Gene PubMed Count 61
PubMed Score 501.08
PubTator Score 186.40

Knowledge Summary

Patent (44,848)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (37)

PMID Text
26349406 Study presents evidence suggesting that the PNOC and OPRL1 are dysregulated in suicide completers, thereby potentially contributing to impaired emotional and behavioral control and, ultimately, to the suicidal crisis
25677778 Data suggest that nociceptin/nociceptin receptor signaling in neurons of the hippocampus modulate learning and memory. [REVIEW]
25677777 Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]
25677776 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of psychological and inflammatory stress responses and in pathogenesis of anxiety. [REVIEW]
25677775 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of the immune response and in pathogenesis of autoimmune diseases. [REVIEW]
25677773 Opioid neuropeptide systems are important mediators of ovarian steroid signaling that regulate reproduction in female; data suggest that nociceptin and nociceptin receptor system in arcuate nucleus of hypothalamus is such a system. [REVIEW]
25677768 Data suggest that nociceptin and nociceptin receptor evolved as one of 4 opioid receptor systems in vertebrates; this system exhibits both analgesic and hyperalgesic effects. [REVIEW]
23799031 Overall methylation levels in the promoter regions of three genes (ALDH1A1, OPRL1 and RGS19) are elevated in subjects who were exposed to childhood adversity.
23740899 Oprl1 is associated with amygdala function, fear processing, and posttraumatic stress disorder symptoms.
23086955 Dominant-positive Arrestin3 but not Arrestin2 was sufficient to rescue NOPR-S363A internalization and JNK signaling.
22849833 Decreased plasma nociceptin/orphanin FQ is closely associated with the presence of acute cardiovascular disease, and the severity of symptoms has a significant negative correlation with the N/OFQ levels.
22596163 crystal structure of human NOP (also known as ORL-1), solved in complex with the peptide mimetic antagonist compound-24
21709374 The presence of at least one C allele is associated with a decreased expression of OLR1 mRNA in the absence of hsa-miR369-3p de-regulation
21656184 Our studies reported here show that ORL1 exhibits the ability to cross-desensitize CXCR4 in both primary leukocytes and hematopoetic cell lines
20888736 OPRL1 expression was 1.83 times higher in vitiligo involved skin when compared to healthy control skin.
20682755 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20032820 study provides evidence for an association of two variants of the OPRL1 gene, rs6090041 and rs6090043, with vulnerability to develop opiate addiction, suggesting a role for nociceptin/orphanin FQ receptor in the development of opiate addiction
20032820 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19501074 Our results support the concept postulating that chronic ethanol consumption and withdrawal downregulate the PNOC/OPRL1 system, which critically controls alcohol intake.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18286384 existence of a cross-talk between NOP and kainate receptors, leading to an interplay between glutamate and N/OFQ circuits
18269382 We genotyped 15 single nucleotide polymorphisms (SNPs) spanning the OPRL1 locus and found that SNP rs6010718 was significantly associated with both Type I and Type II alcoholics.
18269382 Observational study of gene-disease association. (HuGE Navigator)
18247127 Human CD14(+) monocytes expresses the mRNA for ORL1. The ORL1/nociceptin system plays a role in regulating chemotactic responses of leukocytes through chemokine suppression.
18191876 However, there was evidence in support of LD between the OLR1+1071, the OLR1+1073, and the rs669 SNPs, with T-C-A haplotype being associated with significant increased risk of AD.
17910740 We analyzed 10 single nucleotide polymorphisms (SNPs) in OPRL1 and 15 SNPs in PNOC in a sample of 1923 European Americans from 219 multiplex alcohol dependent families
17910740 Observational study of gene-disease association. (HuGE Navigator)
17456499 molecular analysis of the nociceptin receptor and its ligand complexes
17167337 Polymorphism not associated with panic disorder.
16807742 The ORL-1 receptor is expressed by all subtypes of leukocytes; its function is not the modulation of cytokine production and requires further studies.
16800795 Results suggest that opioid receptor-like (ORL1) receptor utilizes both G(oA) and G(oB) for signal transduction.
15276231 Observational study of gene-disease association. (HuGE Navigator)
15016723 Nociceptin-induced receptor endocytosis mainly occurred via clathrin-coated pits. Mainly internalized through the endosome compartment. Receptor phosphorylation necessary for internalization.
14660000 OP4/ORL1 receptor is synthesized and functionally expressed in vascular endothelial cells, presumably as a starting point for some vasoactive mechanism(s).
12576178 Nociceptin receptor mRNA is expressed in human trigeminal ganglia but not in basilar arteries.
12568343 Data show that the dynamic cycle between nociceptin receptor activation, internalization and recycling determines the activity of this receptor on the cell surface.

AA Sequence

MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLAVCVGGLLGNC      1 - 70
LVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFT     71 - 140
LTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDY    141 - 210
WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ    211 - 280
VFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVR    281 - 350
SIAKDVALACKTSETVPRPA                                                      351 - 370
//

Text Mined References (61)

PMID Year Title
26349406 2015 Decreased expression of nociceptin/orphanin FQ in the dorsal anterior cingulate cortex of suicides.
25677778 2015 Nociceptin/orphanin-FQ modulation of learning and memory.
25677777 2015 The neuronal circuit between nociceptin/orphanin FQ and hypocretins/orexins coordinately modulates stress-induced analgesia and anxiety-related behavior.
25677776 2015 Endogenous nociceptin system involvement in stress responses and anxiety behavior.
25677775 2015 Nociceptin/orphanin FQ-NOP receptor system in inflammatory and immune-mediated diseases.
25677773 2015 Orphanin FQ-ORL-1 regulation of reproduction and reproductive behavior in the female.
25677768 2015 Bioinformatics and evolution of vertebrate nociceptin and opioid receptors.
25013167 2014 Evidence of efficient stop codon readthrough in four mammalian genes.
23799031 2013 Profiling of childhood adversity-associated DNA methylation changes in alcoholic patients and healthy controls.
23740899 2013 Amygdala-dependent fear is regulated by Oprl1 in mice and humans with PTSD.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23086955 2012 Serine 363 is required for nociceptin/orphanin FQ opioid receptor (NOPR) desensitization, internalization, and arrestin signaling.
22849833 2012 Decreased plasma nociceptin/orphanin FQ levels after acute coronary syndromes.
22596163 2012 Structure of the nociceptin/orphanin FQ receptor in complex with a peptide mimetic.
21709374 2011 Role of OLR1 and its regulating hsa-miR369-3p in Alzheimer's disease: genetics and expression analysis.
21656184 2011 Nociceptin/orphanin FQ receptor-driven heterologous desensitization of the major HIV-1 co-receptor CXCR4.
20888736 2010 Analysis of the expression profile of CRH-POMC system genes in vitiligo skin biopsies.
20682755 2011 A pilot study of gene/gene and gene/environment interactions in Alzheimer disease.
20032820 2010 Evidence for association of two variants of the nociceptin/orphanin FQ receptor gene OPRL1 with vulnerability to develop opiate addiction in Caucasians.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19501074 2009 Expression of pronociceptin and its receptor is downregulated in the brain of human alcoholics.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18286384 2008 Kainic acid down-regulates NOP receptor density and gene expression in human neuroblastoma SH-SY5Y cells.
18269382 2008 Association between the nociceptin receptor gene (OPRL1) single nucleotide polymorphisms and alcohol dependence.
18247127 2008 Suppression of CCL2/MCP-1 and CCL5/RANTES expression by nociceptin in human monocytes.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18191876 2009 Alpha-2-macroglobulin gene, oxidized low-density lipoprotein receptor-1 locus, and sporadic Alzheimer's disease.
17910740 2008 Association analysis of genes encoding the nociceptin receptor (OPRL1) and its endogenous ligand (PNOC) with alcohol or illicit drug dependence.
17456499 2007 Structural modelling and mutation analysis of a nociceptin receptor and its ligand complexes.
17167337 2007 Lack of polymorphism in genes encoding mGluR 7, mGluR 8, GABA(A) receptor alfa-6 subunit and nociceptin/orphanin FQ receptor and panic disorder.
16807742 2006 [Expression und function of the ORL-1 receptor on human leukocytes].
16800795 2006 Opioid receptor-like (ORL1) receptor utilizes both G(oA) and G(oB) for signal transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276231 2004 No association between polymorphisms in the lectin-like oxidised low density lipoprotein receptor (ORL1) gene on chromosome 12 and Alzheimer's disease in a UK cohort.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15086532 2004 Identification of a novel family of G protein-coupled receptor associated sorting proteins.
15016723 2004 Ligand-regulated internalization of the opioid receptor-like 1: a confocal study.
14660000 2003 Expression of OP4 (ORL1, NOP1) receptors in vascular endothelium.
12801588 2003 Peptide and nonpeptide ligands for the nociceptin/orphanin FQ receptor ORL1: research tools and potential therapeutic agents.
12576178 2003 Nociceptin immunoreactivity and receptor mRNA in the human trigeminal ganglion.
12568343 2002 Agonist-induced internalization and desensitization of the human nociceptin receptor expressed in CHO cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399106 2002 Orphanin FQ/nociceptin blocks chronic morphine-induced tyrosine hydroxylase upregulation.
12393946 The ORL1 receptor: molecular pharmacology and signalling mechanisms.
12130708 2002 Orphanin FQ/nociceptin-mediated desensitization of opioid receptor-like 1 receptor and mu opioid receptors involves protein kinase C: a molecular mechanism for heterologous cross-talk.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11726686 2001 Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs.
11238602 2001 Cutting edge: nociceptin stimulates neutrophil chemotaxis and recruitment: inhibition by aspirin-triggered-15-epi-lipoxin A4.
11097863 2000 Highly potent nociceptin analog containing the Arg-Lys triple repeat.
11090272 2000 A core-promoter region functions bi-directionally for human opioid-receptor-like gene ORL1 and its 5'-adjacent gene GAIP.
10998524 2000 Tissue distribution of the opioid receptor-like (ORL1) receptor.
10965058 Immunoglobulin G1 Fc fragment-tagged human opioid receptor-like receptor retains the ability to inhibit cAMP accumulation.
10692489 2000 Functional inactivation of the nociceptin receptor by alanine substitution of glutamine 286 at the C terminus of transmembrane segment VI: evidence from a site-directed mutagenesis study of the ORL1 receptor transmembrane-binding domain.
10571060 1999 Cloning and characterization of a rabbit ortholog of human Galpha16 and mouse G(alpha)15.
9862775 1999 GalphaL1 (Galpha14) couples the opioid receptor-like1 receptor to stimulation of phospholipase C.
9521323 1998 Nocistatin, a peptide that blocks nociceptin action in pain transmission.
8137918 1994 ORL1, a novel member of the opioid receptor family. Cloning, functional expression and localization.
7566152 1995 Isolation and structure of the endogenous agonist of opioid receptor-like ORL1 receptor.
7500847 1995 Expression of alternate forms of brain opioid 'orphan' receptor mRNA in activated human peripheral blood lymphocytes and lymphocytic cell lines.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.