Property Summary

Ligand Count 1,688
NCBI Gene PubMed Count 95
PubMed Score 308.54
PubTator Score 692.59

Knowledge Summary

Patent (7,765)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Large intestine cancer 126 0.0 0.6
Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0


  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.100 6.6e-04
astrocytic glioma -2.600 3.9e-03
Astrocytoma, Pilocytic -2.500 3.2e-09
atypical teratoid / rhabdoid tumor -2.100 1.8e-04
ependymoma -2.900 4.5e-03
glioblastoma -2.100 8.3e-06
group 3 medulloblastoma -1.900 4.6e-03
medulloblastoma, large-cell -2.700 3.7e-05
oligodendroglioma -2.400 8.7e-03

 GWAS Trait (1)

Gene RIF (84)

AA Sequence

RMERQSTSRVRNTVQDPAYLRDIDGMNKPV                                            351 - 380

Text Mined References (98)

PMID Year Title