Property Summary

NCBI Gene PubMed Count 114
PubMed Score 103.91
PubTator Score 83.55

Knowledge Summary

Patent (2,943)

TINX Plot

  Disease (8)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.800 1.1e-03
Astrocytoma, Pilocytic -1.400 7.9e-04
atypical teratoid / rhabdoid tumor -2.000 2.4e-06
ependymoma -1.900 1.0e-03
group 4 medulloblastoma -1.300 2.8e-02
oligodendroglioma -1.700 1.4e-03
primitive neuroectodermal tumor -1.900 4.2e-03

 GWAS Trait (1)

Gene RIF (90)

AA Sequence

MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLV      1 - 70
MFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLT     71 - 140
MMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWD    141 - 210
TVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIF    211 - 280
VIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRARE    281 - 350
ATARERVTACTPSDGPGGGAAA                                                    351 - 372
//

Text Mined References (115)

PMID Year Title