Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.99
PubTator Score 24.05

Knowledge Summary

Patent (6,747)

Expression

Gene RIF (5)

PMID Text
24941910 Data indicate that opsin5 (OPN5) photoreceptor mediates light-induced Ca(2+) response.
24614639 It dissects a schizophrenic susceptibility gene, NRG1.
24403072 Opn5m may work exclusively as a short wavelength sensor in the brain as well as in the retina with the assistance of an 11-cis-retinal-supplying system.
22043319 UV photoreceptor in human beings OPN5 triggers a UV-sensitive Gi-mediated signaling pathway in the mammalian tissues.
18354391 Genetic variation of the hNP gene may contribute to molecular mechanisms of bipolar disorder and some aspects of memory and intelligence.

AA Sequence

MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEI      1 - 70
MTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSY     71 - 140
GVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLL    141 - 210
PTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRP    211 - 280
DSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH    281 - 350
EEWE                                                                      351 - 354
//

Text Mined References (15)

PMID Year Title
24941910 2014 Light-induced rapid Ca²? response and MAPK phosphorylation in the cells heterologously expressing human OPN5.
24614639 2014 [Neuropsin signaling as a novel therapeutic target of schizophrenia].
24403072 2014 Evolution of mammalian Opn5 as a specialized UV-absorbing pigment by a single amino acid mutation.
22043319 2011 UV-sensitive photoreceptor protein OPN5 in humans and mice.
18354391 2008 Genetic variations of human neuropsin gene and psychiatric disorders: polymorphism screening and possible association with bipolar disorder and cognitive functions.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15774036 2005 The opsins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623103 2003 Neuropsin (Opn5): a novel opsin identified in mammalian neural tissue.
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.