Property Summary

NCBI Gene PubMed Count 23
PubMed Score 96.93
PubTator Score 154.58

Knowledge Summary

Patent (92,093)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Tritanopia 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Color blindness 5 0.0 5.0
Disease Target Count Z-score Confidence
Primary hypomagnesemia 7 3.756 1.9

Expression

Gene RIF (9)

AA Sequence

MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLN      1 - 70
YILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPF     71 - 140
GNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFI    141 - 210
VPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGL    211 - 280
DLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN      281 - 348
//

Text Mined References (23)

PMID Year Title