Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.07
PubTator Score 8.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.600 4.0e-03
ependymoma -3.000 1.6e-15
oligodendroglioma -2.700 2.0e-14
glioblastoma multiforme -2.700 6.6e-22
osteosarcoma 1.162 5.1e-06
group 3 medulloblastoma -3.600 3.9e-04
atypical teratoid/rhabdoid tumor -2.600 2.9e-07
medulloblastoma, large-cell -1.600 1.1e-02
primitive neuroectodermal tumor -2.100 1.3e-03
pediatric high grade glioma -2.400 1.8e-05
pilocytic astrocytoma -2.800 5.4e-07
subependymal giant cell astrocytoma -4.662 3.8e-04
Pick disease -2.200 1.8e-02
progressive supranuclear palsy -1.600 3.9e-02

Gene RIF (1)

PMID Text
18490449 highly sialylglycosylated Opalin has a role in an intermembranous function of the myelin paranodal loops in the central nervous system

AA Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSIEAMEESDRPC      1 - 70
EISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSL     71 - 140
E//

Text Mined References (15)

PMID Year Title
18490449 2008 Opalin, a transmembrane sialylglycoprotein located in the central nervous system myelin paranodal loop membrane.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17442045 2007 An oligodendrocyte enhancer in a phylogenetically conserved intron region of the mammalian myelin gene Opalin.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11814680 2002 Identification and characterization of a novel human brain-specific gene, homologous to S. scrofa tmp83.5, in the chromosome 10q24 critical region for temporal lobe epilepsy and spastic paraplegia.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.