Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.67

Knowledge Summary

Patent

No data available

AA Sequence

MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI      1 - 70
YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD     71 - 140
FQTTAEELGLLSSSPNLL                                                        141 - 158
//

Text Mined References (4)

PMID Year Title