Property Summary

NCBI Gene PubMed Count 10
PubMed Score 157.65
PubTator Score 63.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.100 5.0e-03
sonic hedgehog group medulloblastoma 3.600 3.5e-07
medulloblastoma, large-cell 2.900 7.7e-03
primary pancreatic ductal adenocarcinoma 1.585 5.4e-03
posterior fossa group A ependymoma -1.100 7.0e-12
gastric carcinoma 3.200 1.9e-02
invasive ductal carcinoma 2.400 3.0e-02
ovarian cancer -2.100 5.7e-09
pancreatic cancer 1.600 8.4e-03

Gene RIF (5)

PMID Text
26547929 Data show that ONECUT2, IGF2BP1, and ANXA2 proteins were confirmed to be microRNA-9 (miR-9) targets and aberrantly upregulated in hepatocellular carcinoma (HCC).
24402783 our data showed that transcript factor Onecut2 is involved in the EMT, migration and invasion of CRC cells; miR-429 inhibits the initiation of EMT and regulated expression of EMT-related markers
23472758 Mutations at the -5/-6 site of the F9 promotor account for the majority of hemophilia B Leyden cases and disrupt the binding of ONECUT1 and ONECUT2.
18418398 OC2 transcription factor is a direct target of T-bet in type-1 T-helper cells.
18288132 A CpG island proximal to ONECUT2 is frequently methylated in diffuse large B-cell lymphoma (DLBCL).

AA Sequence

MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQELLASPSPHHA      1 - 70
GRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYRPELSIPLHHAMSMSCDSSPP     71 - 140
GMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHHHHHHQRLSGNVSGSFTLMRDERGLPAMNNL    141 - 210
YSPYKEMPGMSQSLSPLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRG    211 - 280
LGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYS    281 - 350
IPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPNK    351 - 420
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRRSLEKWQDDLS    421 - 490
TGGSSSTSSTCTKA                                                            491 - 504
//

Text Mined References (11)

PMID Year Title
26547929 2015 Comprehensive profiling of novel microRNA-9 targets and a tumor suppressor role of microRNA-9 via targeting IGF2BP1 in hepatocellular carcinoma.
24402783 2014 MiR-429 inhibits cells growth and invasion and regulates EMT-related marker genes by targeting Onecut2 in colorectal carcinoma.
23472758 2013 A CpG mutational hotspot in a ONECUT binding site accounts for the prevalent variant of hemophilia B Leyden.
18418398 2008 Onecut transcription factor OC2 is a direct target of T-bet in type-1 T-helper cells.
18288132 2008 DNA methylation profiles in diffuse large B-cell lymphoma and their relationship to gene expression status.
16912168 2006 MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11478782 2001 The transcription factor onecut-2 controls the microphthalmia-associated transcription factor gene.
9915796 1999 OC-2, a novel mammalian member of the ONECUT class of homeodomain transcription factors whose function in liver partially overlaps with that of hepatocyte nuclear factor-6.