Property Summary

NCBI Gene PubMed Count 30
PubMed Score 85.29
PubTator Score 47.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Protein-protein Interaction (1)

Gene RIF (18)

PMID Text
26825606 Reduced HNF6 expression is associated with metastasis of cholangiocarcinoma.
25653429 HNF6 is a novel host factor that can restrict hepatitis B virus replication via both transcriptional and posttranscriptional mechanisms.
24638272 The negative correlation between HNF6 expression and pancreatic cancer progression suggests that HNF6 maintains pancreatic epithelial homeostasis, and that its loss contributes to the progression from intraepithelial neoplasms to ductal adenocarcinoma.
24022481 HNF6 inhibits EMT, cell migration, and invasive growth through a mechanism involving the transcriptional activation of p53.
23472758 Mutations at the -5/-6 site of the F9 promotor account for the majority of hemophilia B Leyden cases and disrupt the binding of ONECUT1 and ONECUT2.
23291635 HNF6 plays an important role in the gene regulation of CYP3A4 during development from the fetal period to the postnatal period.
22271799 HNF6 and Sox9 are new biomarkers of pancreatic acinar-to-ductal metaplasia and constitute candidate targets for preventive treatment in cases when acinar-to-ductal metaplasia may lead to cancer.
21893194 Hepatocyte nuclear factor 6 is one of the liver-enriched transcription factors, it utilizes the bipartite onecut-homeodomain sequence to localize to the nuclear compartment and bind specific DNA sequences of numerous target gene promoters
20967225 functional knockdown of FOXA2 recovered HNF6 activity and inhibited growth of tumor-cells and may possibly represent a novel therapeutic target in primary and secondary liver malignancies
18976975 Knockdown of one cut homeobox 1 (ONECUT1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18459945 Results suggest that HNF-6 is a novel target of small heterodimer partner in the regulation of gluconeogenesis.
18097590 ONECUT1 expression is lost in pancreatic cancer cells, suggesting a tumor suppressor function in this malignancy.
17283222 HNF6 DNA binding is selectively abrogated through lack of post-translational modification and interaction with FOXA2. Targeting of FOXA2 and HNF6 may therefore enable mechanism-based therapy for colorectal liver metastases
15520459 A comparision of gene expression patterns induced by hepatic nuclear factors, HNF6, HNF4alpha and HNF1beta, in a pancreatic beta-cell line.
15304484 HNF6 protein stability is controlled by CBP acetylation
14988562 identifed systematically the genes occupied by the transcriptional regulators HNF1alpha, HNF4alpha, and HNF6, together with RNA polymerase II in human liver and pancreatic islets
14570708 These findings define a precursor cellular stage of the embryonic pancreas and place Hnf1beta in a genetic hierarchy that regulates the generation of pancreatic endocrine cells.
12509444 HNF6 has a role as a coactivator protein to potentiate the transcriptional activity of another liver factor, FoxA2

AA Sequence

MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLDGGSGGGDYHH      1 - 70
HHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHHHHHHHPHHHQR     71 - 140
LAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTD    141 - 210
KMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQV    211 - 280
SNGSNSGQMEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRM    281 - 350
WKWLQEPEFQRMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ    351 - 420
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA                             421 - 465
//

Text Mined References (31)

PMID Year Title
26825606 2016 Hepatocyte nuclear factor 6 inhibits the growth and metastasis of cholangiocarcinoma cells by regulating miR-122.
25653429 2015 Inhibition of hepatitis B virus gene expression and replication by hepatocyte nuclear factor 6.
24638272 2014 Loss of HNF6 expression correlates with human pancreatic cancer progression.
24022481 2013 Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition.
23472758 2013 A CpG mutational hotspot in a ONECUT binding site accounts for the prevalent variant of hemophilia B Leyden.
23291635 2013 Hepatocyte nuclear factor 6 activates the transcription of CYP3A4 in hepatocyte-like cells differentiated from human induced pluripotent stem cells.
22271799 2012 Role of the ductal transcription factors HNF6 and Sox9 in pancreatic acinar-to-ductal metaplasia.
21920465 2012 A feedback loop between the liver-enriched transcription factor network and miR-122 controls hepatocyte differentiation.
21893194 2012 Pathophysiologic role of hepatocyte nuclear factor 6.
20967225 2010 Inhibition of the liver enriched protein FOXA2 recovers HNF6 activity in human colon carcinoma and liver hepatoma cells.
18459945 2008 Orphan nuclear receptor SHP interacts with and represses hepatocyte nuclear factor-6 (HNF-6) transactivation.
18097590 2008 Loss of ONECUT1 expression in human pancreatic cancer cells.
17283222 2007 The hepatocyte nuclear factor 6 (HNF6) and FOXA2 are key regulators in colorectal liver metastases.
15520459 2004 Pattern of genes influenced by conditional expression of the transcription factors HNF6, HNF4alpha and HNF1beta in a pancreatic beta-cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15304484 2004 Stability of the hepatocyte nuclear factor 6 transcription factor requires acetylation by the CREB-binding protein coactivator.
14988562 2004 Control of pancreas and liver gene expression by HNF transcription factors.
14570708 2003 Hnf6 and Tcf2 (MODY5) are linked in a gene network operating in a precursor cell domain of the embryonic pancreas.
12509444 2003 Association between hepatocyte nuclear factor 6 (HNF-6) and FoxA2 DNA binding domains stimulates FoxA2 transcriptional activity but inhibits HNF-6 DNA binding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379144 2003 Hepatocyte nuclear factor-6 stimulates transcription of the alpha-fetoprotein gene and synergizes with the retinoic-acid-receptor-related orphan receptor alpha-4.
11279202 2001 Protein kinase A phosphorylates hepatocyte nuclear factor-6 and stimulates glucose-6-phosphatase catalytic subunit gene transcription.
10825208 2000 Transcription factor hepatocyte nuclear factor 6 regulates pancreatic endocrine cell differentiation and controls expression of the proendocrine gene ngn3.
10811635 2000 Transcriptional stimulation by hepatocyte nuclear factor-6. Target-specific recruitment of either CREB-binding protein (CBP) or p300/CBP-associated factor (p/CAF).
10491763 1999 Hepatocyte nuclear factor-6: associations between genetic variability and type II diabetes and between genetic variability and estimates of insulin secretion.
10430878 1999 Antiglucocorticoid activity of hepatocyte nuclear factor-6.
9915796 1999 OC-2, a novel mammalian member of the ONECUT class of homeodomain transcription factors whose function in liver partially overlaps with that of hepatocyte nuclear factor-6.
9231664 1997 Pancreatic islet expression studies and polymorphic DNA markers in the genes encoding hepatocyte nuclear factor-3alpha, -3beta, -3gamma, -4gamma, and -6.
8887657 1996 The transcriptional activator hepatocyte nuclear factor 6 regulates liver gene expression.
8790352 1996 Hepatocyte nuclear factor 6, a transcription factor that contains a novel type of homeodomain and a single cut domain.