Property Summary

NCBI Gene PubMed Count 11
PubMed Score 257.24
PubTator Score 207.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Olfactory neuroblastoma 4 4.244 2.1

Expression

Gene RIF (2)

AA Sequence

MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNV      1 - 70
VLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMY     71 - 140
FLVTFGEGVEPANLKASVVFNQL                                                   141 - 163
//

Text Mined References (11)

PMID Year Title