Property Summary

NCBI Gene PubMed Count 21
PubMed Score 155.04
PubTator Score 40.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.800 1.2e-02
posterior fossa group A ependymoma -3.800 2.8e-11
medulloblastoma -5.200 3.6e-11
astrocytoma -1.800 5.0e-03
atypical teratoid / rhabdoid tumor -5.100 5.9e-11
medulloblastoma, large-cell -4.800 4.9e-08
primitive neuroectodermal tumor -3.400 1.3e-03
non-small cell lung cancer -1.825 8.2e-15
pediatric high grade glioma -2.200 4.3e-03
nasopharyngeal carcinoma -3.500 2.1e-07
Endometriosis -1.469 3.1e-02

Gene RIF (5)

PMID Text
21534343 The results do not support a relationship between the OMGP gene and the learning disability phenotype observed in neurofibromatosis type 1.
19034380 Data show that oligodendrocyte-myelin glycoprotein is downregulated in schizophrenia anterior temporal lobe revealed by shotgun proteome analysis.
16425041 Observational study of gene-disease association. (HuGE Navigator)
16425041 novel mutations and novel polymorphisms in coding regions and 5'UTR were detected in patients with with non-syndromic mental retardation
12566166 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDL      1 - 70
HNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVL     71 - 140
IKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQS    141 - 210
FDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTV    211 - 280
SGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAA    281 - 350
ATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN    351 - 420
AWKVNASFLLLLNVVVMLAV                                                      421 - 440
//

Text Mined References (21)

PMID Year Title
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
21534343 Learning disability and oligodendrocyte myelin glycoprotein (OMGP) gene in neurofibromatosis type 1.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17335080 2007 Roles of glial p75NTR in axonal regeneration.
16425041 2006 Mutations and novel polymorphisms in coding regions and UTRs of CDK5R1 and OMG genes in patients with non-syndromic mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12951563 2003 Myelin-associated inhibitors of axonal regeneration in the adult mammalian CNS.
12716421 2003 Oligodendrocyte myelin glycoprotein growth inhibition function requires its conserved leucine-rich repeat domain, not its glycosylphosphatidyl-inositol anchor.
12692556 2003 The p75 receptor acts as a displacement factor that releases Rho from Rho-GDI.
12566166 2003 Molecular analysis of the oligodendrocyte myelin glycoprotein gene in autistic disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426574 2002 A p75(NTR) and Nogo receptor complex mediates repulsive signaling by myelin-associated glycoprotein.
12068310 2002 Oligodendrocyte-myelin glycoprotein is a Nogo receptor ligand that inhibits neurite outgrowth.
8244377 1993 The oligodendrocyte-myelin glycoprotein of mouse: primary structure and gene structure.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3283151 1988 A phosphatidylinositol-linked peanut agglutinin-binding glycoprotein in central nervous system myelin and on oligodendrocytes.
2277079 1990 Structure and chromosomal localization of the gene for the oligodendrocyte-myelin glycoprotein.
1899288 1991 The gene encoding the oligodendrocyte-myelin glycoprotein is embedded within the neurofibromatosis type 1 gene.
1688857 1990 The oligodendrocyte-myelin glycoprotein belongs to a distinct family of proteins and contains the HNK-1 carbohydrate.