Tbio | Osteomodulin |
May be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin (By similarity).
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 2.95986217704747E-11 |
adrenocortical carcinoma | 1427 | 4.48002460796389E-11 |
lung carcinoma | 2844 | 1.59224405152728E-10 |
Atopic dermatitis | 944 | 1.06099767142529E-5 |
invasive ductal carcinoma | 2950 | 0.00136388096720542 |
oligodendroglioma | 2849 | 0.00139233945195539 |
pituitary cancer | 1972 | 0.00240638558222887 |
ependymoma | 2514 | 0.00253719946013394 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.00278025152964288 |
ductal carcinoma in situ | 1745 | 0.0039774350493332 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.00422256332557224 |
sonic hedgehog group medulloblastoma | 1482 | 0.00563446481758109 |
astrocytic glioma | 2241 | 0.0175736074931228 |
psoriasis | 6685 | 0.0221273093274478 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.027680361648581 |
interstitial cystitis | 2299 | 0.0279561128638397 |
cutaneous lupus erythematosus | 1056 | 0.0318394510864632 |
non diabetic and post-ischemic heart failure | 200 | 0.0360296714608781 |
Breast cancer | 3099 | 0.0365574649866383 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.100 | 0.018 |
ependymoma | -1.700 | 0.003 |
oligodendroglioma | -1.700 | 0.001 |
psoriasis | -1.600 | 0.022 |
cutaneous lupus erythematosus | -1.400 | 0.032 |
non diabetic and post-ischemic heart fai... | 1.400 | 0.036 |
Atopic dermatitis | -2.800 | 0.000 |
adrenocortical carcinoma | -2.114 | 0.000 |
intraductal papillary-mucinous adenoma (... | -2.200 | 0.004 |
intraductal papillary-mucinous carcinoma... | -2.400 | 0.003 |
intraductal papillary-mucinous neoplasm ... | -2.300 | 0.028 |
Breast cancer | 2.300 | 0.037 |
interstitial cystitis | -1.500 | 0.028 |
sonic hedgehog group medulloblastoma | 1.400 | 0.006 |
lung carcinoma | -2.100 | 0.000 |
ductal carcinoma in situ | -1.600 | 0.004 |
invasive ductal carcinoma | -2.400 | 0.001 |
ovarian cancer | -2.700 | 0.000 |
pituitary cancer | -1.200 | 0.002 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26003732 | Osteomodulin (OMD) directly binds to type 1 collagen. OMD suppresses formation of collagen fibrils. |
25371314 | Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage. |
19700767 | tyrosine sulfate-rich domains of the LRR proteins fibromodulin and osteoadherin bind motifs of basic clusters in a variety of heparin-binding proteins, including bioactive factors |
12489179 | TGF beta 1 signaling and stimulation of osteoadherin in human pulpal fibroblasts and in early secretory and mature odontoblasts |
MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPT 1 - 70 NFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKL 71 - 140 PNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAK 141 - 210 MEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLP 211 - 280 NIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYI 281 - 350 FFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ 351 - 420 E//
PMID | Year | Title |
---|---|---|
26003732 | 2015 | Osteomodulin regulates diameter and alters shape of collagen fibrils. |
25371314 | 2015 | Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage. |
23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
19700767 | 2009 | The tyrosine sulfate-rich domains of the LRR proteins fibromodulin and osteoadherin bind motifs of basic clusters in a variety of heparin-binding proteins, including bioactive factors. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
15164053 | 2004 | DNA sequence and analysis of human chromosome 9. |
14673660 | 2004 | Immunodetection of osteoadherin in murine tooth extracellular matrices. |
14551184 | 2004 | Identification of tyrosine sulfation in extracellular leucine-rich repeat proteins using mass spectrometry. |
12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. |
12489179 | 2002 | TGF beta 1 signaling and stimulation of osteoadherin in human odontoblasts in vitro. |
More... |