Property Summary

NCBI Gene PubMed Count 12
PubMed Score 526.62
PubTator Score 11.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.202 5.0e-03
intraductal papillary-mucinous adenoma (... 1.300 7.9e-04
posterior fossa group B ependymoma 1.200 2.0e-05
aldosterone-producing adenoma -1.067 4.4e-02
subependymal giant cell astrocytoma 1.486 3.4e-02
psoriasis -1.100 7.4e-07

Gene RIF (7)

PMID Text
25275009 The mitochondrial metalloprotease OMA1 was activated in a Bax- and Bak-dependent fashion.
25112877 These findings demonstrate that (a) p53 and Oma1 mediate L-Opa1 processing, (b) mitochondrial fragmentation is involved in CDDP-induced apoptosis in OVCA and CECA cells, and (c) dysregulated mitochondrial dynamics
24719224 OMA1 is cleaved to a short form (S-OMA1) by itself upon mitochondrial membrane depolarization; S-OMA1 is degraded quickly but could be stabilized by CCCP treatment or Prohibitin knockdown in cells.
24634514 Cleavage of the inner membrane fusion factor L-OPA1 is prevented due to the failure to activate the inner membrane protease OMA1 in mitochondria that have a collapsed membrane potential.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20038677 OMA1 controls OPA1 cleavage and function.
17615298 These results provide evidence for different substrate specificities of m-AAA proteases composed of different subunits and reveal a striking evolutionary switch of proteases involved in the proteolytic processing of dynamin-like GTPases in mitochondria.

AA Sequence

MSFICGLQSAARNHVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDRWSFLPGNFHF      1 - 70
YSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPSLSVLHPLSPASIRAIRNFHTSP     71 - 140
RFQAAPVPLLLMILKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFY    141 - 210
FTHLEVSPITGRSKLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGI    211 - 280
SQINWVIHVVDSPIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFL    281 - 350
GMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQM    351 - 420
EFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEK    421 - 490
EDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS                                        491 - 524
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25605331 2015 C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization.
25275009 2014 Activation of mitochondrial protease OMA1 by Bax and Bak promotes cytochrome c release during apoptosis.
25112877 2014 p53 is required for cisplatin-induced processing of the mitochondrial fusion protein L-Opa1 that is mediated by the mitochondrial metallopeptidase Oma1 in gynecologic cancers.
24719224 2014 Membrane depolarization activates the mitochondrial protease OMA1 by stimulating self-cleavage.
24634514 2014 Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation.
22433842 2012 Loss of mitochondrial protease OMA1 alters processing of the GTPase OPA1 and causes obesity and defective thermogenesis in mice.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20038677 2009 Inducible proteolytic inactivation of OPA1 mediated by the OMA1 protease in mammalian cells.
17615298 2007 OPA1 processing reconstituted in yeast depends on the subunit composition of the m-AAA protease in mitochondria.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886954 2003 Identification of a human cDNA sequence which encodes a novel membrane-associated protein containing a zinc metalloprotease motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.