Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.73
PubTator Score 11.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 4.7e-20
posterior fossa group A ependymoma 1511 3.1e-05
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 3.651 1.8
Celiac disease 112 0.0 2.0

Gene RIF (5)

PMID Text
20921970 SNP within the OLIG3/TNFAIP3 locus (rs6920220) was associated with being less likely to maintain MTX monotherapy
20921970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20353580 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY      1 - 70
KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSS     71 - 140
LEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIR    141 - 210
PPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK            211 - 272
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20921970 2012 A genetic marker at the OLIG3/TNFAIP3 locus associates with methotrexate continuation in early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20453841 2010 A regulatory variant in CCR6 is associated with rheumatoid arthritis susceptibility.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20353580 2010 Evaluation of the rheumatoid arthritis susceptibility loci HLA-DRB1, PTPN22, OLIG3/TNFAIP3, STAT4 and TRAF1/C5 in an inception cohort.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982456 2007 Two independent alleles at 6q23 associated with risk of rheumatoid arthritis.
15769945 2005 The bHLH factor Olig3 coordinates the specification of dorsal neurons in the spinal cord.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11091082 2000 Dynamic expression of basic helix-loop-helix Olig family members: implication of Olig2 in neuron and oligodendrocyte differentiation and identification of a new member, Olig3.