Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.07
PubTator Score 2.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.063 2.3e-04
Atopic dermatitis -1.900 1.2e-03
atypical teratoid / rhabdoid tumor 2.500 8.4e-03
breast carcinoma -1.200 1.6e-14
cystic fibrosis 1.562 9.2e-05
ductal carcinoma in situ -1.300 2.1e-02
ependymoma 2.300 2.2e-04
intraductal papillary-mucinous adenoma (... -2.100 1.2e-03
intraductal papillary-mucinous carcinoma... -2.500 8.1e-04
intraductal papillary-mucinous neoplasm ... -2.700 5.4e-03
invasive ductal carcinoma -1.900 1.5e-03
lung adenocarcinoma -1.400 3.0e-09
lung cancer -1.800 1.2e-02
lung carcinoma -1.700 3.8e-10
non-small cell lung cancer -1.394 1.7e-13
ovarian cancer -4.800 2.2e-23
psoriasis -1.100 1.3e-03
sonic hedgehog group medulloblastoma 1.500 2.4e-04

Gene RIF (1)

AA Sequence

MMVALRGASALLVLFLAAFLPPPQCTQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVM      1 - 70
LGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLAEMLLQEAEEEKKIRTLLNAS     71 - 140
CDNMLMGIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIGSRNNTVWEFANIRAFMEDNTKPAPRKQILT    141 - 210
LSWQGTGQVIYKGFLFFHNQATSNEIIKYNLQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLW    211 - 280
AIHSGPGTHSHLVLTKIEPGTLGVEHSWDTPCRSQDAEASFLLCGVLYVVYSTGGQGPHRITCIYDPLGT    281 - 350
ISEEDLPNLFFPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK                      351 - 402
//

Text Mined References (9)

PMID Year Title