Property Summary

NCBI Gene PubMed Count 58
PubMed Score 52.35
PubTator Score 149.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Obesity 678 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.309 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.374 2.1e-02
active ulcerative colitis 1.409 1.9e-02
Barrett's esophagus 4.200 3.6e-02
Breast cancer -3.900 1.8e-15
esophageal adenocarcinoma 5.100 1.8e-02
gastric carcinoma 6.700 3.8e-02
lung adenocarcinoma 1.500 5.5e-03
osteosarcoma -5.891 1.6e-07
pancreatic cancer 1.500 4.4e-02
primary Sjogren syndrome 2.500 2.0e-04

Gene RIF (39)

AA Sequence

MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLF      1 - 70
SNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVR     71 - 140
IDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVL    141 - 210
AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSP    211 - 280
QHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIAR    281 - 350
VNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT    351 - 420
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKL    421 - 490
YVYNDGYLLNYDLSVLQKPQ                                                      491 - 510
//

Text Mined References (62)

PMID Year Title