Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.85
PubTator Score 7.86

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 2.2e-04
group 3 medulloblastoma 2254 4.7e-02
Disease Target Count Z-score Confidence
Glaucoma 135 3.889 1.9


  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.100 4.7e-02
pilocytic astrocytoma 1.700 2.2e-04

Gene RIF (3)

25298399 Olfm2 physically interacts with serum response factor (SRF) without affecting the SRF-myocardin interaction.
17122126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17122126 The Arg144Gln mutation in OLFM2 is a possible disease-causing mutation in Japanese patients with OAG. Common polymorphisms in OLFM2 and OPTN may interactively contribute to the development of OAG, indicating a polygenic etiology.

AA Sequence

DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP                                        421 - 454

Text Mined References (13)

PMID Year Title
25298399 2014 Olfactomedin 2, a novel regulator for transforming growth factor-?-induced smooth muscle differentiation of human embryonic stem cell-derived mesenchymal cells.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21228389 2011 Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
17122126 2006 SNPs and interaction analyses of noelin 2, myocilin, and optineurin genes in Japanese patients with open-angle glaucoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15123989 2004 Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.