Property Summary

NCBI Gene PubMed Count 16
PubMed Score 24.69
PubTator Score 11.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis -1.900 2.0e-02
interstitial lung disease 1.300 2.5e-02
astrocytoma -4.700 1.4e-03
posterior fossa group A ependymoma -4.400 1.6e-15
oligodendroglioma -2.400 4.1e-17
cutaneous lupus erythematosus -1.300 1.1e-02
psoriasis 1.400 6.3e-03
glioblastoma -5.000 1.6e-04
osteosarcoma 1.729 7.9e-09
medulloblastoma -2.700 8.6e-06
atypical teratoid / rhabdoid tumor -5.100 1.5e-08
medulloblastoma, large-cell -2.600 1.4e-03
primitive neuroectodermal tumor -3.200 1.1e-04
intraductal papillary-mucinous adenoma (... -2.200 2.4e-04
intraductal papillary-mucinous carcinoma... -1.600 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.400 3.1e-02
lung cancer -2.600 7.8e-06
colon cancer -2.300 2.0e-03
interstitial cystitis 1.200 1.0e-02
pediatric high grade glioma -3.600 3.5e-06
pilocytic astrocytoma -2.700 1.8e-07
subependymal giant cell astrocytoma -3.596 4.0e-02
invasive ductal carcinoma -2.200 7.3e-03
Endometriosis 1.989 2.7e-02
spina bifida -1.624 3.9e-02
Pick disease -1.200 8.0e-03
ductal carcinoma in situ -1.200 1.3e-02
ulcerative colitis 2.600 1.0e-06
pituitary cancer -1.900 9.7e-08

Gene RIF (5)

PMID Text
26377223 human chorionic gonadotropin stimulated miR-212, which down-regulated OLFM1 and CTBP1 expression in fallopian and endometrial epithelial cells to favor spheroid attachment
26121352 OLF domains from H. sapiens olfactomedin-1 and M. musculus gliomedin were biophysically, biochemically, and structurally characterized.
25999259 Down-regulation of OLFM1 in fallopian tube epithelial cells enhances spheroid attachment to fallopian tube.
21968811 Wnt activation suppresses Olfm-1 expression, and this may predispose a favorable microenvironment of the retained embryo in the Fallopian tube, leading to ectopic pregnancy in humans
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSE      1 - 70
GRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVE     71 - 140
ESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSR    141 - 210
VSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSM    211 - 280
VDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWG    281 - 350
GHSDIDLMVDESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG    351 - 420
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL         421 - 485
//

Text Mined References (19)

PMID Year Title
26377223 2015 MicroRNA-212 Regulates the Expression of Olfactomedin 1 and C-Terminal Binding Protein 1 in Human Endometrial Epithelial Cells to Enhance Spheroid Attachment In Vitro.
26121352 2015 Molecular Details of Olfactomedin Domains Provide Pathway to Structure-Function Studies.
25999259 2015 Human chorionic gonadotropin stimulates spheroid attachment on fallopian tube epithelial cells through the mitogen-activated protein kinase pathway and down-regulation of olfactomedin-1.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
21968811 2012 Wnt activation downregulates olfactomedin-1 in Fallopian tubal epithelial cells: a microenvironment predisposed to tubal ectopic pregnancy.
21228389 2011 Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15123989 2004 Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
9039501 1996 Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles.
8619474 1996 A "double adaptor" method for improved shotgun library construction.