Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.05
PubTator Score 13.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 6.8e-21
malignant mesothelioma 3163 2.0e-08

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -3.300 2.0e-08
psoriasis -2.000 6.8e-21

 MGI Phenotype (1)

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP      1 - 70
LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR     71 - 140
IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS    141 - 210
EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF                   211 - 265
//

Text Mined References (7)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17082220 2006 Isolation and expression profiling of genes upregulated in bone marrow-derived mononuclear cells of rheumatoid arthritis patients.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.