Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.04
PubTator Score 18.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.441 1.4e-02
Multiple myeloma 2.186 6.8e-04
astrocytic glioma -1.800 7.9e-03
ependymoma -2.200 1.3e-02
oligodendroglioma -1.800 1.8e-02
glioblastoma -2.400 2.8e-06
medulloblastoma -1.500 5.4e-04
atypical teratoid / rhabdoid tumor -2.300 1.9e-05
medulloblastoma, large-cell -1.700 2.1e-03
colon cancer 1.500 6.4e-04
lung cancer 2.400 1.4e-04
pediatric high grade glioma -2.000 6.5e-06
pilocytic astrocytoma -1.600 4.8e-06
subependymal giant cell astrocytoma -1.658 4.8e-02
Pick disease -1.100 3.4e-03

 GO Process (1)

Gene RIF (11)

PMID Text
26360636 HIV-1 MA interacts with OLA1
26283179 Our work suggests that OLA1 is a novel translational GTPase and plays a suppressive role in translation and cell survival, as well as cancer growth and progression.
24486488 OLA1 plays an important negative role in cell adhesion and spreading, in part through the regulation of FAK expression and cofilin phosphorylation, and manipulation of OLA1 may lead to significant changes in cell adhesion and the associated phenotypes.
24289923 OLA1 plays an important role in centrosome regulation together with BRCA1.
23412384 Downregulation of OLA1 in mammalian cells by either RNAi or targeted gene disruption results in reduced steady-state levels of HSP70, impaired HSP70 induction by heat, and functionally, increased cellular sensitivity to heat shock.
22190034 HIV-1 MA interacts with OLA1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20053727 DOC45 is a novel ATPase that is linked to cellular stress response and tumorigenesis, and may also serve as a valuable tumor marker.
19882753 knockdown of OLA1 inhibits breast cancer cell migration and invasion through a mechanism that involves the modulation of intracellular ROS levels
19706404 OLA1 suppresses the antioxidant response through nontranscriptional mechanisms.
18536999 Results indicate that Gbp45/OLA1 plays important roles in cell proliferation and death related to mitochondrial function.

AA Sequence

MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDER      1 - 70
FDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVD     71 - 140
PIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKE    141 - 210
IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQ    211 - 280
KYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKY    281 - 350
EDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK                            351 - 396
//

Text Mined References (34)

PMID Year Title
27271530 2016 OLA1 gene sequencing in patients with BRCA1/2 mutation-negative suspected hereditary breast and ovarian cancer.
26863455 2016 OLA1 contributes to epithelial-mesenchymal transition in lung cancer by modulating the GSK3?/snail/E-cadherin signaling.
26655089 2016 Obg-like ATPase 1 regulates global protein serine/threonine phosphorylation in cancer cells by suppressing the GSK3?-inhibitor 2-PP1 positive feedback loop.
26283179 2015 OLA1 regulates protein synthesis and integrated stress response by inhibiting eIF2 ternary complex formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24486488 2014 Regulation of cell-matrix adhesion by OLA1, the Obg-like ATPase 1.
24411079 2014 OLA1 in centrosome biology alongside the BRCA1/BARD1 complex: looking beyond centrosomes.
24289923 2014 The BRCA1/BARD1-interacting protein OLA1 functions in centrosome regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23412384 2013 OLA1 protects cells in heat shock by stabilizing HSP70.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20053727 2010 DOC45, a novel DNA damage-regulated nucleocytoplasmic ATPase that is overexpressed in multiple human malignancies.
19946888 2010 Defining the membrane proteome of NK cells.
19882753 2009 Knockdown of OLA1, a regulator of oxidative stress response, inhibits motility and invasion of breast cancer cells.
19706404 2009 OLA1, an Obg-like ATPase, suppresses antioxidant response via nontranscriptional mechanisms.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18536999 2008 The identification and characterization of a new GTP-binding protein (Gbp45) involved in cell proliferation and death related to mitochondrial function.
17430889 2007 Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.