Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.64
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GO Function (1)

Gene RIF (8)

PMID Text
26942680 Stable binding of Mis18alpha-Mis18beta heterotetramer to centromeres in telophase licenses them for CENP-A deposition.
26107214 Over-expression of OIP5 was observed in breast tumors.
24519934 Mis18beta binds with and specifies the centromere localization of HJURP.
24269809 this study showed betaTrCP-mediated regulation of Mis18beta stability is a mechanism to restrict centromere function of Mis18 complex from late mitosis to early G1 phase.
23292864 expression of AURKC, OIP5, PIWIL2 and TAF7L differed between patients with Acute myeloid leukemia, myelodysplastic syndrome and healthy controls in a gender-dependent manner
22129094 OIP5 expression was significantly associated with poor prognosis of lung and esophageal cancer patients
20510019 These results indicate that knockdown of OIP5 may induce apoptosis in cancer cells.
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.[Mis18alpha, Mis18beta, M18BP1]

AA Sequence

MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL      1 - 70
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC     71 - 140
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL    141 - 210
KSLMKILSEVTPDQSKPEN                                                       211 - 229
//

Text Mined References (23)

PMID Year Title
26942680 2016 Licensing of Centromeric Chromatin Assembly through the Mis18?-Mis18? Heterotetramer.
26921242 2016 Centromere localization and function of Mis18 requires Yippee-like domain-mediated oligomerization.
26107214 2015 Cancer/Testis OIP5 and TAF7L Genes are Up-Regulated in Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24519934 2014 Mitotic regulator Mis18? interacts with and specifies the centromeric assembly of molecular chaperone holliday junction recognition protein (HJURP).
24269809 2014 ?TrCP-mediated ubiquitylation regulates protein stability of Mis18? in a cell cycle-dependent manner.
23292864 2013 Expression analysis of four testis-specific genes AURKC, OIP5, PIWIL2 and TAF7L in acute myeloid leukemia: a gender-dependent expression pattern.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22129094 2012 Characterization of an Opa interacting protein 5 involved in lung and esophageal carcinogenesis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20510019 2010 OIP5 is a highly expressed potential therapeutic target for colorectal and gastric cancers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17284516 2007 LAP2alpha-binding protein LINT-25 is a novel chromatin-associated protein involved in cell cycle exit.
17199038 2007 Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9466265 1998 Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth.