Property Summary

NCBI Gene PubMed Count 114
PubMed Score 916.62
PubTator Score 480.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphosyte leukemia 1.200 1.6e-05
astrocytic glioma 1.200 6.5e-03
ependymoma 1.400 3.9e-03
oligodendroglioma 1.500 7.4e-04
psoriasis -1.200 6.3e-04
osteosarcoma 1.262 2.6e-03
group 4 medulloblastoma 1.300 2.1e-02
atypical teratoid / rhabdoid tumor 1.100 1.3e-04
glioblastoma -1.100 3.1e-05
hereditary spastic paraplegia -1.021 2.4e-02
pancreatic ductal adenocarcinoma liver m... 1.589 3.2e-03
intraductal papillary-mucinous carcinoma... 1.100 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.3e-02
colon cancer 1.600 1.2e-02
cystic fibrosis -1.100 1.2e-02
subependymal giant cell astrocytoma -2.004 1.1e-02
Alzheimer's disease -1.300 3.1e-02
Pick disease -1.900 2.0e-06
progressive supranuclear palsy -1.400 2.0e-02
ovarian cancer -2.600 9.1e-11
dermatomyositis 1.300 6.7e-04

Protein-protein Interaction (12)

Gene RIF (67)

PMID Text
26854602 Together, these findings suggest that induction of SNO-OGT by Ab exposure is a pathogenic mechanism to cause cellular hypo-O-GlcNAcylation by which Ab neurotoxicity is executed
26807597 Data suggest RNA polymerase II (POLR2A) is extensively modified on its unique C-terminal domain (CTD) by O-GlcNAc transferase (OGT); efficient O-GlcNAcylation requires a minimum of 20 heptad CTD repeats in POLR2A and more than half of NTD of OGT.
26707622 OGT inhibited the formation of the Ecadherin/catenin complex through reducing the interaction between p120 and Ecadherin.
26527687 E2F1 negatively regulates both Ogt and Mgea5 expression in an Rb1 protein-dependent manner.
26408091 a new function of histone O-GlcNAcylation in DNA damage response
26399441 OGT expression is increased under hypoxic conditions.
26397041 We concluded that OGT plays a key role in gastric cancer proliferation and survival, and could be a potential target for therapy.
26305326 These results demonstrate that distinct OGT-binding sites in HCF-1 promote proteolysis, and provide novel insights into the mechanism of this unusual protease activity.
26252736 These results suggested roles of O-GlcNAcylation in modulating serine phosphorylation, as well as in regulating PKM2 activity and expression.
26240142 Use of OGT(C917A) enhances O-GlcNDAz production, yielding improved cross-linking of O-GlcNDAz-modified molecules
26237509 This work reveals that although the N-terminal TPR repeats of OGT may have roles in substrate recognition, the sequence restriction imposed by the peptide-binding site makes a substantial contribution to O-GlcNAc site specificity.
26041297 Inhibition of O-Linked N-Acetylglucosamine Transferase Reduces Replication of Herpes Simplex Virus and Human Cytomegalovirus.
25776937 miR4235p was associated with congestive heart failure and the expression levels of proBNP; in addition, OGT was found to be a direct target of miR4235p.
25773598 Histone demethylase LSD2 acts as an E3 ubiquitin ligase and inhibits cancer cell growth through promoting proteasomal degradation of OGT.
25663381 Hexosamine biosynthetic pathway flux is increased in idiopathic pulmonary artery hypertension and drives OGT-facilitated pulmonary artery smooth muscle cell proliferation via specific proteolysis and direct activation of host cell factor-1.
25568311 Phosphorylation of TET proteins is regulated via O-GlcNAcylation by the O-linked N-acetylglucosamine transferase (OGT).
25419848 O-linked beta-N-acetylglucosamine transferase mediates O-GlcNAcylation of the SNARE protein SNAP-29 and regulates autophagy in a nutrient-dependent manner.
25173736 Amino acid composition of splice variants, post-translational modifications, and stable associations with regulatory proteins influence subcellular distribution/substrate specificity of OGT and OGA (O-GlcNAcase beta-N-acetylglucosaminidase). [REVIEW]
24928395 Instead, an adipogenesis-dependent increase in O-linked beta-N-acetylglucosamine (O-GlcNAc) glycosylation of EWS was observed.
24580054 Endogenous OTX2 from a medulloblastoma cell line is O-GlcNAcylated at several sites.
24394411 OGT catalyzes the O-GlcNAcylation of TET3, promotes TET3 nuclear export, and, consequently, inhibits the formation of 5-hydroxymethylcytosine catalyzed by TET3.
24365779 Estrogen replacement therapy and plyometric training influence muscle OGT and OGA gene expression, which may be one of the mechanisms by which HRT and PT prevent aging-related loss of muscle mass.
24311690 study reports the tetratricopeptide-repeat domain of O-GlcNAc transferase binds the carboxyl-terminal portion of an HCF-1 proteolytic repeat such that the cleavage region lies in the glycosyltransferase active site above uridine diphosphate-GlcNAc; protein glycosylation and HCF-1 cleavage occur in the same active site
24256146 Data suggest that with multi-substrate enzymes, such as OGT, specific inhibition can rarely be achieved with ligands that compete solely with one of the substrates; OGT is inhibited by bisubstrate UDP-oligopeptide conjugates.
23720054 Expression of c-MYC and OGT was tightly correlated in human prostate cancer samples.
23700425 The backbone carbonyl oxygen of Leu653 and the hydroxyl group of Thr560 in OGT contribute to the recognition of sugar moieties via hydrogen bonds.
23642195 Data suggest that changes in OGT (O-linked N-acetylglucosamine transferase) and OGA (peptide O-linked N-acetylglucosamine-beta-N-acetylglucosaminidase) expression are correlated with cancer prognosis. [REVIEW]
23487789 These studies identified OGT as a promising placental biomarker of maternal stress exposure that may relate to sex-biased outcomes in neurodevelopment.
23222540 The double epigenetic modifications on both DNA and histones by TET2 and OGT coordinate together for the regulation of gene transcription.
23152511 The human respiratory syncytial virus-induced sequestration of p38-P in IBs resulted in a substantial reduction in the accumulation of a downstream signaling substrate, MAPK-activated protein kinase 2 (MK2).
23103942 we define how human OGT recognizes the sugar donor and acceptor peptide and uses a new catalytic mechanism of glycosyl transfer, involving the sugar donor alpha-phosphate as the catalytic base as well as an essential lysine
23103939 we describe structural snapshots of all species along the kinetic pathway for human O-linked beta-N-acetylglucosamine transferase (O-GlcNAc transferase), an intracellular enzyme that catalyzes installation of a dynamic post-translational modification
22883232 O-GlcNAc transferase/host cell factor C1 complex regulates gluconeogenesis by modulating PGC-1alpha stability.
22783592 Analysis of urinary content of MGEA5 and OGT may be useful for bladder cancer diagnostics.
22574218 AMPK functions as a physiological suppressor of 26S proteasomes through OGT
22496241 Hsp90 is involved in the regulation of OGT and O-GlcNAc modification and that Hsp90 inhibitors might be used to modulate O-GlcNAc modification and reverse its adverse effects in human diseases.
22384635 O-GlcNAcylation may be an important regulatory modification involved in endometrial cancer pathogenesis but the actual significance of this modification for endometrial cancer progression needs to be investigated further.
22371499 These studies identify a molecular mechanism of GR transrepression, and highlight the function of O-GlcNAc in hormone signaling.
22311971 Data show that the interplay between O-GlcNAc and phosphorylation on proteins and indicate that these effects can be mediated by changes in hOGT and hOGA kinetic activity.
22294689 a 154-amino acid region of MIBP1 was necessary for its O-GlcNAc transferase binding and O-GlcNAcylation.
22275356 as prostate cancer cells alter glucose and glutamine levels, O-GlcNAc modifications and OGT levels become elevated and are required for regulation of malignant properties
21567137 Decrease in MGEA5 and increase in O-GlcNAc transferease expression in higher grade tumors suggests that increased O-GlcNAc modification may be implicated in breast tumor progression and metastasis.
21327254 Data identify Tau as potential substrates for the O-beta-N-acetylglucosaminyltransferase (OGT).
21240259 two crystal structures of human OGT, as a binary complex with UDP (2.8 A resolution) and as a ternary complex with UDP and a peptide substrate (1.95 A).
20876116 OGT deletion in infarcted mice significantly exacerbated cardiac dysfunction.
20845477 Observational study of gene-disease association. (HuGE Navigator)
20824293 Enhanced OGT expression efficiently triggered programmed cell death.
20805223 regulating the amount of OGT during mitosis is important in ensuring correct chromosomal segregation during mitosis.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20206135 OGT could be a co-regulatory subunit shared by functionally distinct complexes supporting epigenetic regulation of MIP-1alpha gene promoter.
20200153 THAP1 was found to bind HCF-1 in vitro and to associate with HCF-1 and OGT in vivo.
20190804 OGT regulates breast cancer tumorignenesis and cancer growth through targeting FixM1.
20068230 Data show that forced overexpression of OGT increased the inhibitory phosphorylation of CDK1 and reduced the phosphorylation of CDK1 target proteins.
19073609 Up-regulation of O-GlcNAc transferase with glucose deprivation in HepG2 cells is mediated by decreased hexosamine pathway flux.
18653473 the O-GlcNAc cycling enzymes associate with kinases and phosphatases at M phase to regulate the posttranslational status of vimentin
18536723 The structure of an intact OGT homolog and kinetic analysis of human OGT variants reveal a contiguous superhelical groove that directs substrates to the active site.
18174169 O-GlcNAc modification stimulated by glucose deprivation results from increased OGT and decreased O-GlcNAcase levels and that these changes affect cell metabolism, thus inactivating glycogen synthase.
16966374 Overall, transcriptional inhibition is related to the integrated effect of O-GlcNAc by direct modification of critical elements of the transcriptome and indirectly through O-GlcNAc modification of the proteasome.
16105839 analysis of the catalytic domain of O-linked N-acetylglucosaminyl transferase
15896326 Thus, stably transfected HeLa cells provide an abundant source of enzyme that can be used to study the structure, function, and regulation of OGT.
15795231 By using a series of 4-methylumbelliferyl 2-deoxy-2-N-fluoroacetyl-beta-D-glucopyranoside substrates, Taft-like linear free energy analyses of these enzymes indicates that O-GlcNAcase uses a catalytic mechanism involving anchimeric assistance
15561949 Staining of OGT in streptozotocin diabetic rat liver is clearly diminished, but it was substantially restored after 6 days of insulin treatment
15336570 OGT can respond rapidly to heat stress through the enhancement of nucleocytoplasmic protein O-GlcNAcylation.
14601650 a novel HLA-A0201-restricted cytotoxic T lymphocyte (CTL)-epitope (28-SLYKFSPFPL; FSP06) derived from a mutant OGT-protein
12136128 O-linked GlcNAc transferase participates in a hexosamine-dependent signaling pathway that is linked to insulin resistance and leptin production
11846551 homology between O-linked GlcNAc transferases and proteins of the glycogen phosphorylase superfamily
11773972 We have delineated the complete genomic structure of human OGT spanning approx 43 kb of genomic DNA in Xq13.1

AA Sequence

MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRR      1 - 70
LDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME     71 - 140
GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLA    141 - 210
IHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAID    211 - 280
TYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY    281 - 350
RKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR    351 - 420
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLV    421 - 490
SIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGY    491 - 560
VSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQ    561 - 630
DGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMP    631 - 700
HTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNT    701 - 770
ALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED    771 - 840
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEE    841 - 910
HVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIA    911 - 980
VKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA        981 - 1046
//

Text Mined References (126)

PMID Year Title
26854602 2016 A?-affected pathogenic induction of S-nitrosylation of OGT and identification of Cys-NO linkage triplet.
26807597 2016 Distributive O-GlcNAcylation on the Highly Repetitive C-Terminal Domain of RNA Polymerase II.
26707622 2016 Inhibition of E-cadherin/catenin complex formation by O-linked N-acetylglucosamine transferase is partially independent of its catalytic activity.
26527687 2015 E2F1 Transcription Factor Regulates O-linked N-acetylglucosamine (O-GlcNAc) Transferase and O-GlcNAcase Expression.
26408091 2015 OGT mediated histone H2B S112 GlcNAcylation regulates DNA damage response.
26399441 2015 O-GlcNAcylation of G6PD promotes the pentose phosphate pathway and tumor growth.
26397041 2015 Silencing ?-linked N-acetylglucosamine transferase induces apoptosis in human gastric cancer cells through PUMA and caspase-3 pathways.
26305326 2015 Distinct OGT-Binding Sites Promote HCF-1 Cleavage.
26273451 2015 Nonsyndromic X-linked intellectual deficiency in three brothers with a novel MED12 missense mutation [c.5922G>T (p.Glu1974His)].
26252736 2015 Alteration of O-GlcNAcylation affects serine phosphorylation and regulates gene expression and activity of pyruvate kinase M2 in colorectal cancer cells.
26240142 2015 Enhanced transfer of a photocross-linking N-acetylglucosamine (GlcNAc) analog by an O-GlcNAc transferase mutant with converted substrate specificity.
26237509 2015 The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
26041297 2015 Inhibition of O-Linked N-Acetylglucosamine Transferase Reduces Replication of Herpes Simplex Virus and Human Cytomegalovirus.
25776937 2015 MicroRNA-423-5p targets O-GlcNAc transferase to induce apoptosis in cardiomyocytes.
25773598 2015 Histone demethylase LSD2 acts as an E3 ubiquitin ligase and inhibits cancer cell growth through promoting proteasomal degradation of OGT.
25663381 2015 O-linked ?-N-acetylglucosamine transferase directs cell proliferation in idiopathic pulmonary arterial hypertension.
25568311 2015 Phosphorylation of TET proteins is regulated via O-GlcNAcylation by the O-linked N-acetylglucosamine transferase (OGT).
25419848 2014 O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
25173736 2014 O-GlcNAc transferase and O-GlcNAcase: achieving target substrate specificity.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24928395 2014 Adipogenesis stimulates the nuclear localization of EWS with an increase in its O-GlcNAc glycosylation in 3T3-L1 cells.
24580054 2014 Microarray discovery of new OGT substrates: the medulloblastoma oncogene OTX2 is O-GlcNAcylated.
24474760 2014 O-GlcNAcylation regulates EZH2 protein stability and function.
24394411 2014 Differential regulation of the ten-eleven translocation (TET) family of dioxygenases by O-linked ?-N-acetylglucosamine transferase (OGT).
24365779 2013 OGT and OGA expression in postmenopausal skeletal muscle associates with hormone replacement therapy and muscle cross-sectional area.
24311690 2013 HCF-1 is cleaved in the active site of O-GlcNAc transferase.
24256146 2014 Bisubstrate UDP-peptide conjugates as human O-GlcNAc transferase inhibitors.
23777819 2013 Quantitative regulation of nuclear pore complex proteins by O-GlcNAcylation.
23720054 2013 O-GlcNAc transferase integrates metabolic pathways to regulate the stability of c-MYC in human prostate cancer cells.
23700425 2013 Substrate specificity provides insights into the sugar donor recognition mechanism of O-GlcNAc transferase (OGT).
23642195 2013 O-GlcNAc cycling: a link between metabolism and chronic disease.
23487789 2013 O-GlcNAc transferase (OGT) as a placental biomarker of maternal stress and reprogramming of CNS gene transcription in development.
23353889 2013 TET2 and TET3 regulate GlcNAcylation and H3K4 methylation through OGT and SET1/COMPASS.
23352454 2013 Tet proteins connect the O-linked N-acetylglucosamine transferase Ogt to chromatin in embryonic stem cells.
23222540 2013 TET2 promotes histone O-GlcNAcylation during gene transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152511 2013 p38 and OGT sequestration into viral inclusion bodies in cells infected with human respiratory syncytial virus suppresses MK2 activities and stress granule assembly.
23103942 2012 O-GlcNAc transferase invokes nucleotide sugar pyrophosphate participation in catalysis.
23103939 2012 Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22923583 2012 Phosphofructokinase 1 glycosylation regulates cell growth and metabolism.
22883232 2012 O-GlcNAc transferase/host cell factor C1 complex regulates gluconeogenesis by modulating PGC-1? stability.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22783592 2012 Prediction of bladder cancer based on urinary content of MGEA5 and OGT mRNA level.
22574218 2012 Regulation of the proteasome by AMPK in endothelial cells: the role of O-GlcNAc transferase (OGT).
22496241 2012 Hsp90 regulates O-linked ?-N-acetylglucosamine transferase: a novel mechanism of modulation of protein O-linked ?-N-acetylglucosamine modification in endothelial cells.
22384635 2012 Expression of genes encoding for enzymes associated with O-GlcNAcylation in endometrial carcinomas: clinicopathologic correlations.
22371499 2012 O-GlcNAc transferase is involved in glucocorticoid receptor-mediated transrepression.
22311971 2012 Insights into O-linked N-acetylglucosamine ([0-9]O-GlcNAc) processing and dynamics through kinetic analysis of O-GlcNAc transferase and O-GlcNAcase activity on protein substrates.
22294689 2012 Genome-wide repression of NF-?B target genes by transcription factor MIBP1 and its modulation by O-linked ?-N-acetylglucosamine (O-GlcNAc) transferase.
22275356 2012 Critical role of O-Linked ?-N-acetylglucosamine transferase in prostate cancer invasion, angiogenesis, and metastasis.
22121020 2011 GlcNAcylation of histone H2B facilitates its monoubiquitination.
21567137 2012 Gene expression of O-GlcNAc cycling enzymes in human breast cancers.
21327254 2011 Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation.
21295698 2011 O-GlcNAc transferase catalyzes site-specific proteolysis of HCF-1.
21285374 2011 Crosstalk between O-GlcNAcylation and proteolytic cleavage regulates the host cell factor-1 maturation pathway.
21269460 2011 Initial characterization of the human central proteome.
21240259 2011 Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
20876116 2010 O-linked ?-N-acetylglucosamine transferase is indispensable in the failing heart.
20845477 2011 Glucose metabolism gene polymorphisms and clinical outcome in pancreatic cancer.
20824293 2011 Elevated O-GlcNAc-dependent signaling through inducible mOGT expression selectively triggers apoptosis.
20805223 2010 O-GlcNAc transferase regulates mitotic chromatin dynamics.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20206135 2010 Glucose-induced expression of MIP-1 genes requires O-GlcNAc transferase in monocytes.
20200153 2010 The THAP-zinc finger protein THAP1 associates with coactivator HCF-1 and O-GlcNAc transferase: a link between DYT6 and DYT3 dystonias.
20190804 2010 Nutrient sensor O-GlcNAc transferase regulates breast cancer tumorigenesis through targeting of the oncogenic transcription factor FoxM1.
20068230 2010 Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.
20018868 2010 Regulation of insulin receptor substrate 1 (IRS-1)/AKT kinase-mediated insulin signaling by O-Linked beta-N-acetylglucosamine in 3T3-L1 adipocytes.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19451179 2009 Reduced O-GlcNAcylation links lower brain glucose metabolism and tau pathology in Alzheimer's disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19377461 2009 GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.
19073609 2009 Up-regulation of O-GlcNAc transferase with glucose deprivation in HepG2 cells is mediated by decreased hexosamine pathway flux.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18653473 2008 A mitotic GlcNAcylation/phosphorylation signaling complex alters the posttranslational state of the cytoskeletal protein vimentin.
18536723 2008 Structure of an O-GlcNAc transferase homolog provides insight into intracellular glycosylation.
18288188 2008 Phosphoinositide signalling links O-GlcNAc transferase to insulin resistance.
18174169 2008 Glucose deprivation stimulates O-GlcNAc modification of proteins through up-regulation of O-linked N-acetylglucosaminyltransferase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17882263 2007 Requirement for O-linked N-acetylglucosaminyltransferase in lymphocytes activation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16966374 2006 O-GlcNAc integrates the proteasome and transcriptome to regulate nuclear hormone receptors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16105839 2005 Mutational analysis of the catalytic domain of O-linked N-acetylglucosaminyl transferase.
15896326 2005 Turnover and characterization of UDP-N-acetylglucosaminyl transferase in a stably transfected HeLa cell line.
15795231 2005 O-GlcNAcase uses substrate-assisted catalysis: kinetic analysis and development of highly selective mechanism-inspired inhibitors.
15561949 2004 Insulin stimulates and diabetes inhibits O-linked N-acetylglucosamine transferase and O-glycosylation of Sp1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361863 2004 The superhelical TPR-repeat domain of O-linked GlcNAc transferase exhibits structural similarities to importin alpha.
15336570 2004 OGT functions as a catalytic chaperone under heat stress response: a unique defense role of OGT in hyperthermia.
14601650 2003 Identification of an HLA-A0201-restricted CTL epitope generated by a tumor-specific frameshift mutation in a coding microsatellite of the OGT gene.
12911634 2003 UDP-N-acetylglucosaminyl transferase (OGT) in brain tissue: temperature sensitivity and subcellular distribution of cytosolic and nuclear enzyme.
12724313 2003 Roles of the tetratricopeptide repeat domain in O-GlcNAc transferase targeting and protein substrate specificity.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12538765 2003 Mitochondrial and nucleocytoplasmic targeting of O-linked GlcNAc transferase.
12504895 2003 Mitochondrial and nucleocytoplasmic isoforms of O-linked GlcNAc transferase encoded by a single mammalian gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435728 2003 Identification and cloning of a novel family of coiled-coil domain proteins that interact with O-GlcNAc transferase.
12373287 2002 The role of O-linked protein glycosylation in beta-cell dysfunction.
12226704 2002 Emerging links between initiation of translation and human diseases.
12150998 2002 Recruitment of O-GlcNAc transferase to promoters by corepressor mSin3A: coupling protein O-GlcNAcylation to transcriptional repression.
12136128 2002 Altered glycan-dependent signaling induces insulin resistance and hyperleptinemia.
11773972 2002 Human O-GlcNAc transferase (OGT): genomic structure, analysis of splice variants, fine mapping in Xq13.1.
10801981 2000 The O-GlcNAc transferase gene resides on the X chromosome and is essential for embryonic stem cell viability and mouse ontogeny.
10753899 2000 Functional expression of O-linked GlcNAc transferase. Domain structure and substrate specificity.
10580430 1999 Localization of the O-linked N-acetylglucosamine transferase in rat pancreas.
10386995 1999 Glycosylation sites flank phosphorylation sites on synapsin I: O-linked N-acetylglucosamine residues are localized within domains mediating synapsin I interactions.
9499386 1998 SV40 large T antigen is modified with O-linked N-acetylglucosamine but not with other forms of glycosylation.
9343410 1997 O glycosylation of an Sp1-derived peptide blocks known Sp1 protein interactions.
9110174 1997 Large-scale concatenation cDNA sequencing.
9083068 1997 O-Linked GlcNAc transferase is a conserved nucleocytoplasmic protein containing tetratricopeptide repeats.
9083067 1997 Dynamic glycosylation of nuclear and cytosolic proteins. Cloning and characterization of a unique O-GlcNAc transferase with multiple tetratricopeptide repeats.
8910513 1996 The microtubule-associated protein tau is extensively modified with O-linked N-acetylglucosamine.
8702840 1996 Cytoplasmic O-GlcNAc modification of the head domain and the KSP repeat motif of the neurofilament protein neurofilament-H.
8639509 1996 Dynamic O-GlcNAcylation of the small heat shock protein alpha B-crystallin.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8344946 1993 Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.
8063760 1994 Clathrin assembly protein AP-3 is phosphorylated and glycosylated on the 50-kDa structural domain.
7642555 1995 c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas.
1730617 1992 Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine.
1533623 1992 Glycosylation of nuclear and cytoplasmic proteins. Purification and characterization of a uridine diphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase.
1512232 1992 Localization of O-GlcNAc modification on the serum response transcription factor.