Property Summary

Ligand Count 1
NCBI Gene PubMed Count 133
PubMed Score 993.68
PubTator Score 480.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Alzheimer's disease -1.300 3.1e-02
astrocytic glioma 1.200 6.5e-03
atypical teratoid / rhabdoid tumor 1.100 1.3e-04
Chronic Lymphocytic Leukemia 1.122 2.8e-03
colon cancer 1.600 1.2e-02
cystic fibrosis -1.100 1.2e-02
dermatomyositis 1.300 6.7e-04
ependymoma 1.400 3.9e-03
glioblastoma -1.100 3.1e-05
group 4 medulloblastoma 1.300 2.1e-02
hereditary spastic paraplegia -1.021 2.4e-02
intraductal papillary-mucinous carcinoma... 1.100 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.3e-02
oligodendroglioma 1.500 7.4e-04
osteosarcoma -1.177 1.8e-03
ovarian cancer -1.100 1.3e-02
pancreatic ductal adenocarcinoma liver m... 1.257 1.2e-02
Pick disease -1.400 5.9e-06
progressive supranuclear palsy -1.300 8.8e-03
psoriasis -1.200 6.3e-04
subependymal giant cell astrocytoma -2.004 1.1e-02

PDB (25)

Gene RIF (86)

AA Sequence

MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRR      1 - 70
LDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME     71 - 140
GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLA    141 - 210
IHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAID    211 - 280
TYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY    281 - 350
RKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR    351 - 420
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLV    421 - 490
SIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGY    491 - 560
VSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQ    561 - 630
DGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMP    631 - 700
HTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNT    701 - 770
ALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED    771 - 840
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEE    841 - 910
HVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIA    911 - 980
VKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA        981 - 1046
//

Text Mined References (145)

PMID Year Title