Property Summary

Ligand Count 77
NCBI Gene PubMed Count 4
PubMed Score 0.84
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.990 2.4e-04
atypical teratoid / rhabdoid tumor -2.500 8.4e-05
Breast cancer 2.500 2.7e-02
breast carcinoma -1.400 6.3e-23
cystic fibrosis 2.201 1.2e-06
ependymoma 1.500 1.0e-02
glioblastoma -1.500 3.7e-04
group 3 medulloblastoma -1.700 3.6e-04
interstitial cystitis 1.100 2.3e-04
invasive ductal carcinoma -1.500 3.6e-03
lung cancer -1.200 1.5e-02
lung carcinoma -2.200 1.4e-30
malignant mesothelioma 1.500 2.2e-06
medulloblastoma, large-cell -3.100 6.1e-06
non primary Sjogren syndrome sicca 1.100 3.3e-02
osteosarcoma 1.348 1.9e-02
ovarian cancer -3.100 1.6e-07
pediatric high grade glioma -1.600 7.6e-05
primitive neuroectodermal tumor -1.700 2.0e-03
subependymal giant cell astrocytoma 1.095 4.7e-02
ulcerative colitis 1.600 1.7e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MGNLLGGVSFREPTTVEDCDSTWQTDSEPEPEEPGPGGGSEGPGQESEQPAQPPEQAGGRPGASPAPDED      1 - 70
AEAAGAEQGGDSTEATAKPKRSFYAARDLYKYRHQYPNFKDIRYQNDLSNLRFYKNKIPFKPDGVYIEEV     71 - 140
LSKWKGDYEKLEHNHTYIQWLFPLREQGLNFYAKELTTYEIEEFKKTKEAIRRFLLAYKMMLEFFGIKLT    141 - 210
DKTGNVARAVNWQERFQHLNESQHNYLRITRILKSLGELGYESFKSPLVKFILHEALVENTIPNIKQSAL    211 - 280
EYFVYTIRDRRERRKLLRFAQKHYTPSENFIWGPPRKEQSEGSKAQKMSSPLASSHNSQTSMHKKAKDSK    281 - 350
NSSSAVHLNSKTAEDKKVAPKEPVEETDRPSPEPSNEAAKPRNTEKDSNAENMNSQPEKTVTTPTEKKES    351 - 420
VSPENNEEGGNDNQDNENPGNTNCHDVVLVQ                                           421 - 451
//

Text Mined References (6)

PMID Year Title