Property Summary

NCBI Gene PubMed Count 25
PubMed Score 75.44
PubTator Score 46.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.6e-05
osteosarcoma 7933 3.6e-05
psoriasis 6685 1.8e-04
Disease Target Count Z-score Confidence
Keratopathy 12 3.135 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 1.8e-04
osteosarcoma 1.016 3.6e-05
medulloblastoma, large-cell -1.100 2.6e-05

Gene RIF (13)

PMID Text
25853862 The blockade of OGF signaling by MNTX releases cells from their arrest and boosts the effect of Doc
23856908 The OGF-OGFr axis may be a feasible target for treatment of cancer of the ovary (i) in a prophylactic fashion, (ii) following cytoreduction or (iii) in conjunction with standard chemotherapy for additive effectiveness
22328595 OGF-OGFr axis is a determinant of the progression of human ovarian cancer
19923357 These data are the first to report that theOGFr system is a native biological regulator of cell proliferation in Hepatocellular carcinoma
19835629 OGF and OGFR are present in follicular-derived thyroid cancers, and that OGF serves in a inhibitory manner to maintain homeostasis of cell proliferation.
19675283 Opioid growth factor-opioid growth factor receptor axis is a physiological determinant of cell proliferation in diverse human cancers.
19297547 Cell proliferation of human ovarian cancer is regulated by the opioid growth factor-opioid growth factor receptor axis.
19244545 the regulation of cell proliferation by the OGF-OGFr axis is dependent on nucleocytoplasmic translocation and reliant on the integrity of two NLSs in OGFr to interact with transport receptors.
18923142 Results indicate that both p16(INK4a) and p21(WAF1/CIP1) are required for the opioid growth factor (OGF)-OGF receptor axis to inhibit cell proliferation in normal cells.
18636152 supports opioid growth factor receptor (OGFr) gene function as a regulator of cell proliferation that impacts on tumorigenic expression, and suggest that molecular and pharmacological manipulation of OGFr may prevent or delay human pancreatic cancer.
17273790 These data indicate that the OGF receptor is integral to cell replication of SCCHN, and support treatment modalities that amplify OGFr in order to decrease the growth of these neoplasias.
16820893 Opioid growth factor receptor is unaltered with the progression of human pancreatic and colon cancers
16685459 Gene therapy to reinstate more OGFr and enhance OGFr function, could serve as a useful treatment for inhibiting tumor progression in head and neck cancers.

AA Sequence

MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATR      1 - 70
DMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREP     71 - 140
GVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNN    141 - 210
LRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRP    211 - 280
RCKFVWGPQDKLRRFKPSSLPHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSV    281 - 350
EPQDAGPLERSQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS    351 - 420
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGH    421 - 490
PKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSE    491 - 560
TPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPA    561 - 630
GDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSGKP                           631 - 677
//

Text Mined References (37)

PMID Year Title
26687326 2016 Antagonism of the Met5-enkephalin-opioid growth factor receptor-signaling axis promotes MSC to differentiate into osteoblasts.
25853862 2015 Peripheral opioid antagonist enhances the effect of anti-tumor drug by blocking a cell growth-suppressive pathway in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23856908 2013 Targeting the opioid growth factor: opioid growth factor receptor axis for treatment of human ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22328595 2012 Under-expression of the opioid growth factor receptor promotes progression of human ovarian cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19923357 2010 The opioid growth factor-opioid growth factor receptor axis regulates cell proliferation of human hepatocellular cancer.
19835629 2009 Growth inhibition of thyroid follicular cell-derived cancers by the opioid growth factor (OGF) - opioid growth factor receptor (OGFr) axis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19675283 2009 Opioid growth factor-opioid growth factor receptor axis is a physiological determinant of cell proliferation in diverse human cancers.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19297547 2009 Cell proliferation of human ovarian cancer is regulated by the opioid growth factor-opioid growth factor receptor axis.
19244545 2009 Dependence on nuclear localization signals of the opioid growth factor receptor in the regulation of cell proliferation.
18923142 2009 The OGF-OGFr axis utilizes the p16INK4a and p21WAF1/CIP1 pathways to restrict normal cell proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636152 2008 Prevention and delay in progression of human pancreatic cancer by stable overexpression of the opioid growth factor receptor.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17273790 2007 Overexpression of the opioid growth factor receptor downregulates cell proliferation of human squamous carcinoma cells of the head and neck.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16820893 2006 Opioid growth factor receptor is unaltered with the progression of human pancreatic and colon cancers.
16685459 2006 Progression of squamous cell carcinoma of the head and neck is associated with down-regulation of the opioid growth factor receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12650964 2003 Immunoelectron microscopic localization of the opioid growth factor receptor (OGFr) and OGF in the cornea.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11890982 2002 The biology of the opioid growth factor receptor (OGFr).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
10974024 2000 Detection of a potent humoral response associated with immune-induced remission of chronic myelogenous leukemia.
10677613 2000 Cloning, sequencing, chromosomal location, and function of cDNAs encoding an opioid growth factor receptor (OGFr) in humans.