Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.117 4.9e-03
malignant mesothelioma -1.200 6.0e-06
glioblastoma 1.400 5.8e-06
ependymoma 1.200 3.1e-08
tuberculosis 1.100 2.6e-06
intraductal papillary-mucinous neoplasm ... -1.300 9.1e-03
lung cancer 1.500 3.9e-03
breast carcinoma 1.200 1.3e-02
pediatric high grade glioma 1.500 4.3e-05
atypical teratoid/rhabdoid tumor 1.200 9.2e-05
pilocytic astrocytoma 1.500 1.5e-06
subependymal giant cell astrocytoma 1.513 7.0e-03
ovarian cancer 1.900 7.3e-04
pituitary cancer 1.300 6.8e-05
dermatomyositis 1.100 1.9e-03

AA Sequence

MAPQRRAATKAPEGNGAAERRNRSSTKKDRAPREVQRLWQRPWLRTAGLGAGFVLTALLLWSSLGADDGV      1 - 70
AEVLARRGEVVAGRFIEVPCSEDYDSHRRFEGCTPRKCGRGVTDVVITREEAERIRSVAEKGLSLGGSDG     71 - 140
GASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRLYREVRQKVQLTIAEAFGISASSLHLTKPTF    141 - 210
FSRINSTEARTAHDEYWHAHVDKVTYGSFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFF    211 - 280
TSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIEDPAFP                                   281 - 319
//

Text Mined References (7)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.