Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.96
PubTator Score 22.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.900 2.3e-02
osteosarcoma 1.567 1.2e-04
ovarian cancer 1.600 7.3e-06
primary pancreatic ductal adenocarcinoma 1.086 8.8e-03
psoriasis -2.700 3.5e-05
subependymal giant cell astrocytoma 1.097 2.3e-02
tuberculosis and treatment for 3 months -1.100 1.2e-03

Gene RIF (4)

AA Sequence

MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDPFLHCVIPNFI      1 - 70
QSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILFEDFRSWLSDISKIDLESTID     71 - 140
MSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSMGGTLDLYSIDEHFQPKQIVKSLIPSWNKLVFF    141 - 210
EVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQ    211 - 280
VQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRS    281 - 350
EALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPE    351 - 420
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEEL    421 - 490
LTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE                      491 - 542
//

Text Mined References (14)

PMID Year Title