Property Summary

NCBI Gene PubMed Count 21
PubMed Score 290.51
PubTator Score 51.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.400 2.7e-03
dermatomyositis -2.300 1.9e-04
ependymoma 2.200 1.3e-02
glioblastoma 1.500 1.0e-02
group 4 medulloblastoma 1.200 2.1e-02
malignant mesothelioma 1.400 2.0e-06
medulloblastoma, large-cell 1.500 2.6e-04
oligodendroglioma 2.100 1.3e-03
ovarian cancer -1.100 1.0e-06
psoriasis -1.200 1.2e-03

Gene RIF (10)

AA Sequence

MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPK      1 - 70
SVHKSWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIR     71 - 140
GHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRL    141 - 210
EMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGL    211 - 280
EGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYH    281 - 350
LGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV    351 - 420
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVA    421 - 490
AEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEIS    491 - 560
KYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFT    561 - 630
IHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTC    631 - 700
IPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWV    701 - 770
RQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFH    771 - 840
VLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYY    841 - 910
DLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRA    911 - 980
KPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS                               981 - 1023
//

Text Mined References (31)

PMID Year Title