Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.26
PubTator Score 6.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.8e-10
medulloblastoma, large-cell 6234 2.2e-04

Gene RIF (3)

PMID Text
23096689 Two alternative splice variants of ODF3 and ODF4, were found.
22588436 ODF4 is a cancer-testis (CT) gene useful for detection of CML. It was expressed in 30% of CML patients but not in any of the healthy donors.
12728016 Genomic structure has evolved independently of mouse, whereas functional structure is well-conserved

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQRQNSPLPFQW      1 - 70
RITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFYK     71 - 140
SRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILCYFNHKSFWSL    141 - 210
ILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQKDTHV                           211 - 257
//

Text Mined References (6)

PMID Year Title
23096689 2012 Expression of splice variants of cancer-testis genes ODF3 and ODF4 in the testis of a prostate cancer patient.
22588436 Expression of testis-specific genes, TEX101 and ODF4, in chronic myeloid leukemia and evaluation of TEX101 immunogenicity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15270212 2004 Isolation and expression analysis of the testis-specific gene, human OPPO1.
12728016 2003 Molecular cloning and characterization of the human orthologue of the oppo 1 gene encoding a sperm tail protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.