Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.87
PubTator Score 6.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.8e-10
medulloblastoma, large-cell 6241 2.2e-04
Disease Target Count Z-score Confidence
transitional cell carcinoma 22 3.09 1.5

Expression

Gene RIF (3)

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQRQNSPLPFQW      1 - 70
RITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFYK     71 - 140
SRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILCYFNHKSFWSL    141 - 210
ILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQKDTHV                           211 - 257
//

Text Mined References (7)

PMID Year Title