Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.18
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.5e-05
ovarian cancer 8520 2.0e-05
osteosarcoma 7950 6.8e-05
non-inflammatory breast cancer 66 2.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
non-inflammatory breast cancer 1.300 2.3e-02
osteosarcoma 1.029 6.8e-05
ovarian cancer -1.100 2.0e-05
psoriasis -1.300 1.5e-05

Synonym

Accession Q3SX64 Q3SX65 Q8N1L2
Symbols C19orf19

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MGTLSCDSTPRLATAPLGRRVTEGQIPETGLRKSCGTATLENGSGPGLYVLPSTVGFINHDCTRVASPAY      1 - 70
SLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGPGAYSPEKVPPVRHRTP     71 - 140
PAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIFTKPSSPSYTVVGRTPPARPPQDPAEIPGPGQYDSP    141 - 210
DANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTMAATTPSRPA    211 - 280
GHRLPGRCC                                                                 281 - 289
//

Text Mined References (6)

PMID Year Title