Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.08
PubTator Score 2.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.8e-06
Disease Target Count Z-score Confidence
Basal cell carcinoma 54 3.261 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.631 3.8e-06

Gene RIF (3)

AA Sequence

MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY      1 - 70
NVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPA     71 - 140
AYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPG    141 - 210
DKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE                              211 - 254
//

Text Mined References (9)

PMID Year Title