Property Summary

NCBI Gene PubMed Count 21
PubMed Score 28.52
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
glioblastoma multiforme 347 2.9e-17
atypical teratoid / rhabdoid tumor 4369 2.6e-05
group 4 medulloblastoma 1875 5.8e-04
ependymoma 2514 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Latex allergy 4 3.944 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 2.300 1.0e-02
glioblastoma multiforme 1.100 2.9e-17
atypical teratoid / rhabdoid tumor 1.200 2.6e-05
group 4 medulloblastoma 1.100 5.8e-04

Gene RIF (7)

PMID Text
22911743 Cby plays an important role in organization of both primary and motile cilia in collaboration with Cnx.
21325031 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20234188 Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation.
19386263 A splice variant of hODF2 called hCenexin1, but not hODF2 itself, efficiently localizes to somatic centrosomes via a variant-specific C-terminal extension and recruits Plk1 through a Cdc2-dependent phospho-S796 motif within the extension.
16966375 We propose that hCenexin1 is a critical centrosomal component whose C-terminal extension is required for proper recruitment of Plk1 and other components crucial for normal mitosis.
9740324 Mouse and rat ODF2 protein homolog sequences and expression are compared.

AA Sequence

MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVRVKTKVPWMPP      1 - 70
GKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSE     71 - 140
VKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKECLMSK    141 - 210
LVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCK    211 - 280
EDSERLMEQQGALLKRLAEADSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQ    281 - 350
AQLRSKEAENSRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYA    351 - 420
EQLHVQLADKDLYVAEALSTLESWRSRYNQVVKEKGDLELEIIVLNDRVTDLVNQQQTLEEKMREDRDSL    421 - 490
VERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDNYKSQVMKTRLEADEV    491 - 560
AAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKITEAKLAECQDQLQGYERKNIDLTAI    561 - 630
ISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLR    631 - 700
LEEKTRECGTLARQLESAIEDARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADR    701 - 770
RYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA               771 - 829
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400999 2013 The microtubule affinity regulating kinase MARK4 promotes axoneme extension during early ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911743 2012 A Wnt/beta-catenin pathway antagonist Chibby binds Cenexin at the distal end of mother centrioles and functions in primary cilia formation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21325031 2011 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20234188 2010 Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19386263 2009 Plk1-dependent and -independent roles of an ODF2 splice variant, hCenexin1, at the centrosome of somatic cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16980960 2006 The Plk1 target Kizuna stabilizes mitotic centrosomes to ensure spindle bipolarity.
16966375 2006 Requirement of hCenexin for proper mitotic functions of polo-like kinase 1 at the centrosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11774369 2002 Keratins: unraveling the coordinated construction of scaffolds in spermatogenic cells.
10381817 1999 Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa.
10072582 1998 Human outer dense fiber gene, ODF2, localizes to chromosome 9q34.
9740324 1998 Mouse Odf2 cDNAs consist of evolutionary conserved as well as highly variable sequences and encode outer dense fiber proteins of the sperm tail.
9045620 1997 Interactional cloning of the 84-kDa major outer dense fiber protein Odf84. Leucine zippers mediate associations of Odf84 and Odf27.