Property Summary

NCBI Gene PubMed Count 22
PubMed Score 50.22
PubTator Score 69.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Infertility 188 3.469 1.7
Male infertility 206 3.415 1.7

Expression

Gene RIF (3)

AA Sequence

MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDL      1 - 70
YPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVK     71 - 140
VRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCS    141 - 210
PCSPCSPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL                                  211 - 250
//

Text Mined References (22)

PMID Year Title