Property Summary

NCBI Gene PubMed Count 19
PubMed Score 96.56
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.2e-08
Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.4

Synonym

Accession P0CE71 P32930 Q6ISI5 Q75MW0
Symbols OM
OCM

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (19)

PMID Year Title