Property Summary

NCBI Gene PubMed Count 19
PubMed Score 89.66
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 3.2e-08
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0

Synonym

Accession P0CE71 P32930 Q6ISI5 Q75MW0
Symbols OCM

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

 HCA RNA Cell Line (1)

Gene RIF (1)

PMID Text
23832597 This study deministrated that Parvalbumin-immunoreactive neurons in the human claustrum.

AA Sequence

MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (19)

PMID Year Title
23832597 2014 Parvalbumin-immunoreactive neurons in the human claustrum.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15610002 2004 Solution structure of human beta-parvalbumin and structural comparison with its paralog alpha-parvalbumin and with their rat orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12583602 2002 Calcium-binding proteins: distribution and implication in mammalian placenta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9847074 1998 Toward a complete human genome sequence.
9405492 1998 Oncomodulin is expressed exclusively by outer hair cells in the organ of Corti.
8611623 1996 The Ca2+(-)binding proteins parvalbumin and oncomodulin and their genes: new structural and functional findings.
8354278 1993 Human alpha and beta parvalbumins. Structure and tissue-specific expression.
8077283 1994 Calmodulin-like effect of oncomodulin on cell proliferation.
4005827 1985 The widely-distributed tumour protein, oncomodulin, is a normal constituent of human and rodent placentas.
3558395 1987 A complete complementary DNA for the oncodevelopmental calcium-binding protein, oncomodulin.
3179268 1988 Disulfide-linked dimer of oncomodulin: comparison to calmodulin.
2306116 1990 Inhibition of glutathione reductase by oncomodulin.
1559707 1992 The genes for the highly homologous Ca(2+)-binding proteins oncomodulin and parvalbumin are not linked in the human genome.