Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.12
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.500 1.4e-02
ependymoma 1.700 6.1e-03
oligodendroglioma 1.700 3.7e-03
osteosarcoma 1.769 2.1e-06
medulloblastoma, large-cell -1.100 3.5e-05
pancreatic ductal adenocarcinoma liver m... 1.760 2.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
non primary Sjogren syndrome sicca 1.200 2.9e-02
Alzheimer's disease -1.100 1.9e-02
Pick disease -1.300 1.2e-05
ovarian cancer 1.900 3.5e-04

Synonym

Accession Q9NX40 C9K030 G8JLN7 Q9BZE8
Symbols OCIA
ASRIJ
TPA018

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein OCIA domain containing 1 (OCIAD1) in cells
22726067 Like OCIAD1, OCIAD2 is a cancer-related protein and its expression level increases during the course of malignant progression and is thought to be a very useful marker for evaluating the malignancy of ovarian mucinous tumors.
22081784 OCIAD1 is a potential biomarker of thyroid carcinoma but had no significant additive effect on the risk of distant metastasis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20515946 This is the first study to indicate that OCIAD1 is a key player in generating ovarian cancer recurrence.
19460752 Knockdown of OCIA domain containing 1 (OCIAD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18328549 Over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibility of OCIAD1's role in tumor metastasis.

AA Sequence

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH      1 - 70
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG     71 - 140
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY    141 - 210
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE                                       211 - 245
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22726067 2012 Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.
22081784 2012 Expression of NCAM and OCIAD1 in well-differentiated thyroid carcinoma: correlation with the risk of distant metastasis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20515946 2010 Role of the 18:1 lysophosphatidic acid-ovarian cancer immunoreactive antigen domain containing 1 (OCIAD1)-integrin axis in generating late-stage ovarian cancer.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18328549 2008 Ovarian cancer immuno-reactive antigen domain containing 1 (OCIAD1), a key player in ovarian cancer cell adhesion.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11162530 2001 Molecular cloning of a novel human gene on chromosome 4p11 by immunoscreening of an ovarian carcinoma cDNA library.