Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.62
PubTator Score 10.50

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease -1.100 1.9e-02
astrocytic glioma 1.500 1.4e-02
ependymoma 1.700 6.1e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
medulloblastoma, large-cell -1.100 3.5e-05
non primary Sjogren syndrome sicca 1.200 2.9e-02
oligodendroglioma 1.700 3.7e-03
osteosarcoma 1.769 2.1e-06
ovarian cancer -1.600 2.2e-05
pancreatic ductal adenocarcinoma liver m... 1.760 2.7e-03
Pick disease -1.300 1.2e-05

Gene RIF (7)

AA Sequence

EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE                                       211 - 245

Text Mined References (26)

PMID Year Title