Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27.33
PubTator Score 13.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Three M Syndrome 2 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count
3-M syndrome 15

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.427 1.8e-04
adult high grade glioma -1.100 1.2e-02
astrocytic glioma 1.100 1.3e-03
atypical teratoid / rhabdoid tumor 1.800 6.9e-07
breast carcinoma -1.200 7.0e-05
cutaneous lupus erythematosus -1.300 9.5e-03
ependymoma 1.600 2.3e-02
glioblastoma 1.100 2.8e-05
group 4 medulloblastoma -1.900 1.1e-05
intraductal papillary-mucinous adenoma (... -1.800 3.5e-04
intraductal papillary-mucinous carcinoma... -1.800 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.8e-02
lung cancer 1.500 1.1e-03
medulloblastoma, large-cell -1.700 1.5e-04
Multiple myeloma -1.114 1.8e-03
oligodendroglioma 1.300 3.3e-03
osteosarcoma 1.262 8.0e-07
ovarian cancer -1.100 1.1e-02
primary Sjogren syndrome -1.700 7.5e-03
psoriasis -1.500 9.1e-09

PDB (10)

Gene RIF (13)

AA Sequence

MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL      1 - 70
LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL     71 - 140
RGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCH    141 - 210
ARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWH    211 - 280
WEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDV    281 - 350
EGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT    351 - 420
VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTRE    421 - 490
DAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGS    491 - 560
EDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDG    561 - 630
EDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP    631 - 700
GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRK    701 - 770
HRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW    771 - 840
YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAA    841 - 910
VRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT    911 - 980
VTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPA    981 - 1050
AQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLE   1051 - 1120
VEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEP   1121 - 1190
VVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV   1191 - 1260
QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQG   1261 - 1330
ARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVT   1331 - 1400
PGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEV   1401 - 1470
ETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQL   1471 - 1540
RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVS   1541 - 1610
FTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG   1611 - 1680
TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGR   1681 - 1750
WELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTV   1751 - 1820
LVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTR   1821 - 1890
LLVEGN                                                                   1891 - 1896
//

Text Mined References (28)

PMID Year Title