Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.14
PubTator Score 48.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.384 1.8e-02
Multiple myeloma 2.058 9.6e-05
atypical teratoid / rhabdoid tumor -1.100 8.4e-05
intraductal papillary-mucinous neoplasm ... -1.400 1.6e-03
lung cancer -3.700 4.1e-02
diabetes mellitus -1.600 1.0e-03
ovarian cancer 3.700 2.0e-05

Synonym

Accession P54368 O43382 Q14989 Q92595 Q9UPL9 ODC-Az
Symbols AZI
OAZ

Gene

PANTHER Protein Class (1)

PDB

4ZGZ   4ZGY   5BWA  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (22)

PMID Text
26305948 Data show the the interplay between the enzyme ornithine decarboxylase (ODC) and two regulatory proteins: antizyme (Az) and inhibitor (AzIN).
25318549 Results show that ornithine decarboxylase antizyme 1 (OAZ1) simultaneously inhibits the proliferation and induces the differentiation of oral cancer cells.
24930035 the effects of AZ on cell growth are independent of polyamines.
24192781 To further understand its functions in CML pathogenesis, OAZ1 was overexpressed, and PCR array analysis was used to monitor the expression of key genes commonly involved in leukemia development.
23260169 Gene expression studies have identified altered expression of ornithine decarboxylase antizyme 1 in suicide completers with a history of mood disorders.
22157018 In the absence of amino acids, mTORC1 is inhibited, whereas mTORC2 is activated, leading to the inhibition of global protein synthesis and increased AZ1 synthesis via a cap-independent mechanism.
22008221 This study demomistrated that H3K4me3 modification plays an important role in up regulation of AOAZ1 in prefrontal cortex.
21931692 AZ_95-176 is the minimal AZ peptide that is fully functioning in the binding of ODC and AZI and inhibition of their function.
21552531 the differences in residues 125 and 140 in ODC and AZI are responsible for the differential antizyme-binding affinities
20861309 Data show that OAZ promotes the removal of Mps1 from centrosomes, and centrosome overproduction caused by reducing OAZ activity requires Mps1.
20185758 These data together demonstrate the existence of a c-Jun-dependent mechanism regulating the abundance of the antiapoptotic DNp73 in response to genotoxic stress.
19635796 Data suggest that residue 331 may play a major role in the dimerization of AZI, and the mutating Ser-331 to Tyr in AZI (AZI-S331Y) caused a shift from a monomer configuration to a dimer.
18089576 Yeast antizyme mediates degradation of yeast ornithine decarboxylase by yeast but not by mammalian proteasome: new insights on yeast antizyme
17761941 Observational study of gene-disease association. (HuGE Navigator)
17761941 Identified the OAZ1+2222A/G polymorphism as a potential genetic marker of vascular events.
17630775 Ornithine decarboxylase antizyme 1 enhances the ability of UM1 human oral squamous cancer cells to repair DNA double-strand breaks by the nonhomologous end-joining pathway.
16373339 OAZ can alter the intensity and duration of the BMP4 stimulus through Smad6
16061000 Observational study of gene-disease association. (HuGE Navigator)
15670771 This study also suggests that highly expressed AZI may be partly responsible for increased ODC activity and cellular transformation.
15476163 Special polymorphism haplotype of OAZ gene is associated with Chinese systemic lupus erythematosus. OAZ may suggest a new pathway for lupus.
15355308 Human AZI is capable of acting as a general inhibitor for all members of the antizyme family.
7813017 antizyme expression requires programmed, ribosomal frameshifting

AA Sequence

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDA      1 - 70
PHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLY     71 - 140
IEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPD    141 - 210
ACFMAYTFERESSGEEEE                                                        211 - 228
//

Text Mined References (38)

PMID Year Title
26305948 2015 Structural basis of antizyme-mediated regulation of polyamine homeostasis.
25318549 2014 Effects of ornithine decarboxylase antizyme 1 on the proliferation and differentiation of human oral cancer cells.
24930035 2014 Antizyme (AZ) regulates intestinal cell growth independent of polyamines.
24192781 2014 Assay of OAZ1 mRNA levels in chronic myeloid leukemia combined with application of leukemia PCR array identified relevant gene changes affected by antizyme.
23260169 2013 Effects of promoter methylation on increased expression of polyamine biosynthetic genes in suicide.
22157018 2012 Amino acids regulate expression of antizyme-1 to modulate ornithine decarboxylase activity.
22008221 2012 Effects of histone modifications on increased expression of polyamine biosynthetic genes in suicide.
21931692 2011 Minimal antizyme peptide fully functioning in the binding and inhibition of ornithine decarboxylase and antizyme inhibitor.
21552531 2011 Critical factors governing the difference in antizyme-binding affinities between human ornithine decarboxylase and antizyme inhibitor.
20861309 2010 Antizyme restrains centrosome amplification by regulating the accumulation of Mps1 at centrosomes.
20185758 2010 The antiapoptotic DeltaNp73 is degraded in a c-Jun-dependent manner upon genotoxic stress through the antizyme-mediated pathway.
19635796 2009 Critical factors determining dimerization of human antizyme inhibitor.
18089576 2008 Yeast antizyme mediates degradation of yeast ornithine decarboxylase by yeast but not by mammalian proteasome: new insights on yeast antizyme.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17900240 2008 Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.
17761941 2007 Association of OAZ1 gene polymorphisms with subclinical and clinical vascular events.
17630775 2007 Ornithine decarboxylase antizyme upregulates DNA-dependent protein kinase and enhances the nonhomologous end-joining repair of DNA double-strand breaks in human oral cancer cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16373339 2006 OAZ regulates bone morphogenetic protein signaling through Smad6 activation.
16120325 2003 Mitochondrial localization of antizyme is determined by context-dependent alternative utilization of two AUG initiation codons.
16061000 2005 [Variations within OLF1/EBF-associated zinc finger protein gene confer susceptibility to lupus nephritis in Chinese population].
15670771 2005 Stable siRNA-mediated silencing of antizyme inhibitor: regulation of ornithine decarboxylase activity.
15476163 2004 [OAZ gene polymorphism in Chinese patients with systemic lupus erythematosus].
15355308 2005 Regulation of all members of the antizyme family by antizyme inhibitor.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359729 2002 Structural elements of antizymes 1 and 2 are required for proteasomal degradation of ornithine decarboxylase.
12097147 2002 A novel link between the proteasome pathway and the signal transduction pathway of the bone morphogenetic proteins (BMPs).
10781034 2000 Polyamines in spermiogenesis: not now, darling.
10473601 1999 Antizyme2 is a negative regulator of ornithine decarboxylase and polyamine transport.
9426243 1997 Characterization of the human antizyme gene.
9132164 1996 Molcecular cloning of human antizyme cDNA.
8954789 1996 Assignment of the human antizyme gene (OAZ) to chromosome 19p13.3 by fluorescence in situ hybridization.
8185631 1994 Functional regions of ornithine decarboxylase antizyme.
8001569 1994 A unified pathway for the degradation of ornithine decarboxylase in reticulocyte lysate requires interaction with the polyamine-induced protein, ornithine decarboxylase antizyme.
7813017 1995 Autoregulatory frameshifting in decoding mammalian ornithine decarboxylase antizyme.
7811704 1994 Molecular cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme.
2724368 1989 Chloroform-induced multiple forms of ornithine decarboxylase: differential sensitivity of forms to enhancement by diethyl maleate and inhibition by ODC-antizyme.