Property Summary

NCBI Gene PubMed Count 36
PubMed Score 22.01
PubTator Score 48.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 8.4e-05
diabetes mellitus -1.600 1.0e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.6e-03
lung cancer -3.700 4.1e-02
Multiple myeloma 2.058 9.6e-05
ovarian cancer -1.600 4.2e-07
Waldenstrons macroglobulinemia 1.384 1.8e-02

Gene RIF (22)

AA Sequence

MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCSDA      1 - 70
PHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLY     71 - 140
IEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPD    141 - 210
ACFMAYTFERESSGEEEE                                                        211 - 228
//

Text Mined References (39)

PMID Year Title