Property Summary

NCBI Gene PubMed Count 38
PubMed Score 42.04
PubTator Score 29.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (25)

Disease log2 FC p
Atopic dermatitis 1.300 4.3e-05
atypical teratoid / rhabdoid tumor 1.100 1.1e-03
Barrett's esophagus 1.900 1.5e-02
COPD -1.200 1.0e-02
cutaneous lupus erythematosus 5.100 2.5e-06
cystic fibrosis 1.602 2.6e-04
esophageal adenocarcinoma 1.200 2.0e-02
glioblastoma 1.300 2.7e-04
inflammatory breast cancer 1.600 1.9e-02
interstitial cystitis 1.200 8.6e-03
intraductal papillary-mucinous adenoma (... 1.900 5.5e-04
intraductal papillary-mucinous carcinoma... 1.500 7.5e-03
intraductal papillary-mucinous neoplasm ... 2.000 7.7e-03
invasive ductal carcinoma 1.042 2.9e-02
juvenile dermatomyositis 1.353 1.5e-09
lung cancer -1.400 6.6e-03
lung carcinoma -1.100 2.3e-11
malignant mesothelioma 5.000 1.2e-08
Multiple Sclerosis 2.700 7.3e-03
non-small cell lung cancer -1.321 1.2e-09
ovarian cancer 1.300 3.8e-04
pancreatic cancer 1.900 6.2e-07
psoriasis 3.300 2.9e-10
Systemic lupus erythematosus 1.300 9.8e-04
tuberculosis and treatment for 3 months -1.100 2.1e-02

Gene RIF (21)

AA Sequence

MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSF      1 - 70
GNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPDALVFTI     71 - 140
QTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFSELQRNFVKHRPTKLKSLL    141 - 210
RLVKHWYQQYVKARSPRANLPPLYALELLTIYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKY    211 - 280
YTLHNAIIEDCVRKQLKKERPIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKR    281 - 350
ARDIHLTVEQRGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS    351 - 420
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLG    421 - 490
IYGIQDSDTLILSKKKGEALFPAS                                                  491 - 514
//

Text Mined References (42)

PMID Year Title