Property Summary

NCBI Gene PubMed Count 36
PubMed Score 31.75
PubTator Score 29.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
systemic lupus erythematosus 1.300 9.8e-04
malignant mesothelioma 5.000 1.2e-08
Barrett's esophagus 1.900 1.5e-02
esophageal adenocarcinoma 1.200 2.0e-02
psoriasis 4.500 9.6e-223
cutaneous lupus erythematosus 5.100 2.5e-06
cystic fibrosis 2.200 5.3e-03
atypical teratoid / rhabdoid tumor 1.100 1.1e-03
glioblastoma 1.300 2.7e-04
juvenile dermatomyositis 1.353 1.5e-09
Atopic dermatitis 1.300 4.3e-05
tuberculosis and treatment for 3 months -1.100 2.1e-02
non-small cell lung cancer -1.321 1.2e-09
intraductal papillary-mucinous adenoma (... 1.900 5.5e-04
intraductal papillary-mucinous carcinoma... 1.500 7.5e-03
intraductal papillary-mucinous neoplasm ... 2.000 7.7e-03
lung cancer -1.400 6.6e-03
pancreatic cancer 1.900 6.2e-07
Multiple Sclerosis 2.700 7.3e-03
interstitial cystitis 1.200 8.6e-03
invasive ductal carcinoma 1.200 9.0e-03
inflammatory breast cancer 1.600 1.9e-02
COPD -1.400 2.6e-03
lung carcinoma -1.100 2.3e-11
ovarian cancer 1.300 3.8e-04

Gene RIF (20)

PMID Text
26178980 OASL acts as a cellular antiviral protein and RSV NS1 suppresses this function to evade cellular innate immunity and allow virus growth.
26116899 HIV-1 Vpr upregulates the gene expression of OASL in human monocyte-derived dendritic cells
24931123 these findings show a mechanism by which human OASL contributes to host antiviral responses by enhancing RIG-I activation.
24742347 HIV-1 Vpr upregulates the gene expression of OASL in human monocyte-derived dendritic cells
24328427 Primary mononuclear cells from patients with systemic sclerosis have increased basal levels of OASL and OAS2 genes.
23306614 we propose that VSV treatment combined with the selective regulation of genes such as STAT1 and OASL2 will improve therapeutic outcomes for CUG2-overexpressing tumors
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
21050126 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20506645 The expression of OASL and IFIT2 was significantly higher in SLE patients than in controls.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20074559 OASLa, a major isoform of OASL induced in human liver, may mediate anti-HCV activity through two different domains.
19559055 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19460752 Knockdown of 2'-5'-oligoadenylate synthetase-like (OASL) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19203244 The pronounced difference in gene regulation between the OASL gene agrees with a functional difference between these genes, which must exist as a consequence of the lack of the 2-5A synthetase activity of the OASL protein.
18931074 Proof that OASL is an antiviral protein that works through a novel mechanism distinct from other OASL proteins in other vertebrate species.
18571276 Observational study of gene-disease association. (HuGE Navigator)
16235172 Observational study of gene-disease association. (HuGE Navigator)
14728690 interaction with methyl CpG-binding protein 1 was confirmed in vitro and in vivo and was mapped to the ubiquitin-like domain of p59 OASL

AA Sequence

MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSF      1 - 70
GNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPDALVFTI     71 - 140
QTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFSELQRNFVKHRPTKLKSLL    141 - 210
RLVKHWYQQYVKARSPRANLPPLYALELLTIYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKY    211 - 280
YTLHNAIIEDCVRKQLKKERPIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKR    281 - 350
ARDIHLTVEQRGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS    351 - 420
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLG    421 - 490
IYGIQDSDTLILSKKKGEALFPAS                                                  491 - 514
//

Text Mined References (40)

PMID Year Title
26178980 2015 2'-5'-Oligoadenylate Synthetase-Like Protein Inhibits Respiratory Syncytial Virus Replication and Is Targeted by the Viral Nonstructural Protein 1.
24931123 2014 Antiviral activity of human OASL protein is mediated by enhancing signaling of the RIG-I RNA sensor.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
24328427 2014 Differential upregulation of human 2'5'OAS genes on systemic sclerosis: Detection of increased basal levels of OASL and OAS2 genes through a qPCR based assay.
23306614 2013 Cancer upregulated gene 2, a novel oncogene, confers resistance to oncolytic vesicular stomatitis virus through STAT1-OASL2 signaling.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22531715 2012 Identification of OASL d, a splice variant of human OASL, with antiviral activity.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
21142819 2011 The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.
21050126 2010 Variability in the 2'-5'-oligoadenylate synthetase gene cluster is associated with human predisposition to tick-borne encephalitis virus-induced disease.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20506645 2010 [Interferon-inducible genes 2', 5'-ollgoadenylate synthetase-like and tetratricopeptide repeats 2 are correlated with clinical features of patients with systemic lupus erythematosus].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20074559 2010 2',5'-Oligoadenylate synthetase-like gene highly induced by hepatitis C virus infection in human liver is inhibitory to viral replication in vitro.
19946888 2010 Defining the membrane proteome of NK cells.
19904482 2009 Evolution of the 2'-5'-oligoadenylate synthetase family in eukaryotes and bacteria.
19559055 2009 A pharmacogenetic study of polymorphisms in interferon pathway genes and response to interferon-alpha treatment in chronic hepatitis B patients.
19203244 2009 Differential regulation of the OASL and OAS1 genes in response to viral infections.
18931074 2008 The p59 oligoadenylate synthetase-like protein possesses antiviral activity that requires the C-terminal ubiquitin-like domain.
18571276 2008 Association of single nucleotide polymorphisms in interferon signaling pathway genes and interferon-stimulated genes with the response to interferon therapy for chronic hepatitis C.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17408844 The human 2'-5'oligoadenylate synthetase family: unique interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16235172 2005 Single nucleotide polymorphisms in genes for 2'-5'-oligoadenylate synthetase and RNase L inpatients hospitalized with West Nile virus infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14728690 2004 Interaction between the 2'-5' oligoadenylate synthetase-like protein p59 OASL and the transcriptional repressor methyl CpG-binding protein 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
10087211 1999 The human 2',5'-oligoadenylate synthetase-like gene (OASL) encoding the interferon-induced 56-kDa protein maps to chromosome 12q24.2 in the proximity of the 2',5'-OAS locus.
9826176 1998 Molecular cloning and characterization of two related and interferon-induced 56-kDa and 30-kDa proteins highly similar to 2'-5' oligoadenylate synthetase.
9722630 1998 p59OASL, a 2'-5' oligoadenylate synthetase like protein: a novel human gene related to the 2'-5' oligoadenylate synthetase family.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.
776974 1976 Selective inhibition of the dnase activity of the recBC enzyme by the DNA binding protein from Escherichia coli.