Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.08
PubTator Score 114.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
systemic lupus erythematosus 1.500 4.7e-04
malignant mesothelioma 3.300 3.0e-09
psoriasis 2.500 6.1e-08
cutaneous lupus erythematosus 3.300 7.3e-06
osteosarcoma 1.399 1.6e-03
posterior fossa group A ependymoma 1.400 7.2e-05
glioblastoma 1.900 3.7e-04
atypical teratoid / rhabdoid tumor 1.100 2.2e-03
juvenile dermatomyositis 2.406 2.5e-14
Atopic dermatitis 1.600 3.2e-04
tuberculosis 2.100 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
lung cancer -2.200 3.4e-05
pancreatic cancer 1.300 1.3e-04
Multiple Sclerosis 3.000 8.0e-03
cystic fibrosis 1.500 1.9e-03
pediatric high grade glioma 1.600 1.6e-04
pilocytic astrocytoma 1.200 3.6e-05
primary Sjogren syndrome 1.400 1.3e-03
lung adenocarcinoma 1.100 1.2e-04
Breast cancer 1.800 3.7e-09
lung carcinoma -1.100 8.0e-09
breast carcinoma 1.300 2.0e-22
invasive ductal carcinoma 1.100 1.7e-02
ulcerative colitis 1.400 7.8e-06
dermatomyositis 1.100 2.3e-02

Gene RIF (19)

PMID Text
26858407 OAS3 displayed a higher affinity for dsRNA in intact cells than either OAS1 or OAS2, consistent with its dominant role in RNase L activation.
26398832 Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients.
26116899 HIV-1 Vpr upregulates the gene expression of OAS3 in human monocyte-derived dendritic cells
26063222 By means of an allelic association study of a cohort of 740 patients with dengue, the authors found a protective effect of OAS3_R381 against shock.
25363670 Common variation at 12q24.13 (OAS3 intron) influences chronic lymphocytic leukemia risk.
25275129 The combined high affinity for double-stranded RNA and the capability to produce 2'-5'-linked oligoadenylates of sufficient length to activate RNase L suggests that OAS3 is a potent activator of RNase L.
24162774 HIV-1 Vpr upregulates the gene expression of OAS3 in human monocyte-derived dendritic cells
23337612 The results suggest that OAS1-OAS3-OAS2 haplotypes are associated with differential susceptibility to clinical outcomes of dengue infection.
23196181 among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV
21050126 The data suggest a possible association between OAS2 and OAS3 single nucleotide polymorphisms and the outcome of tick-borne encephalitis virus infection in a Russian population.
21050126 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
19667218 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19559055 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17408844 OAS are interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation [review]
16014697 Observational study of gene-disease association. (HuGE Navigator)
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
1708818 HIV-1 Vpr upregulates the gene expression of OAS3 in human monocyte-derived dendritic cells

AA Sequence

MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALK      1 - 70
GGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLED     71 - 140
WMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWY    141 - 210
HQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAV    211 - 280
GQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC    281 - 350
SGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI    351 - 420
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFLNCFTDYKDQG    421 - 490
PRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSWTDVSLLPAFDAVGQLSSGTK    491 - 560
PNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKNLILLVKHWYRQVAAQNKGKGPAPASLPPAY    561 - 630
ALELLTIFAWEQGCRQDCFNMAQGFRTVLGLVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLD    631 - 700
PADPTWNVGHGSWELLAQEAAALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFL    701 - 770
AQVNKAVDTICSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII    771 - 840
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLVSGSRPSSQVY    841 - 910
VDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKISKGRGSLPPQHGLELLTVYAW    911 - 980
EQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKDKTVGDFLKQQLQKPRPIILDPADPTGNLGH    981 - 1050
NARWDLLAKEAAACTSALCCMGRNGIPIQPWPVKAAV                                    1051 - 1087
//

Text Mined References (37)

PMID Year Title
26858407 2016 Activation of RNase L is dependent on OAS3 expression during infection with diverse human viruses.
26398832 2016 Association of Oligoadenylate Synthetase Gene Cluster and DC-SIGN (CD209) Gene Polymorphisms with Clinical Symptoms in Chikungunya Virus Infection.
26063222 2015 High Anti-Dengue Virus Activity of the OAS Gene Family Is Associated With Increased Severity of Dengue.
25363670 2015 Common variation at 12q24.13 (OAS3) influences chronic lymphocytic leukemia risk.
25275129 2014 The 2'-5'-oligoadenylate synthetase 3 enzyme potently synthesizes the 2'-5'-oligoadenylates required for RNase L activation.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23337612 2013 Polymorphisms in the oligoadenylate synthetase gene cluster and its association with clinical outcomes of dengue virus infection.
23196181 2013 The ribonuclease L-dependent antiviral roles of human 2',5'-oligoadenylate synthetase family members against hepatitis C virus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21270382 2011 Genome-wide association studies identify genetic loci related to alcohol consumption in Korean men.
21269460 2011 Initial characterization of the human central proteome.
21142819 2011 The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.
21050126 2010 Variability in the 2'-5'-oligoadenylate synthetase gene cluster is associated with human predisposition to tick-borne encephalitis virus-induced disease.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
19923450 2009 Distinct antiviral roles for human 2',5'-oligoadenylate synthetase family members against dengue virus infection.
19904482 2009 Evolution of the 2'-5'-oligoadenylate synthetase family in eukaryotes and bacteria.
19667218 2009 Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis.
19559055 2009 A pharmacogenetic study of polymorphisms in interferon pathway genes and response to interferon-alpha treatment in chronic hepatitis B patients.
19056102 2009 The large form of human 2',5'-Oligoadenylate Synthetase (OAS3) exerts antiviral effect against Chikungunya virus.
17408844 The human 2'-5'oligoadenylate synthetase family: unique interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16014697 2006 Type 1 diabetes and the OAS gene cluster: association with splicing polymorphism or haplotype?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
11280764 2001 Molecular basis of T cell-mediated recognition of pancreatic cancer cells.
11112351 2000 Characterization of the gene encoding the 100-kDa form of human 2',5' oligoadenylate synthetase.
9880533 1999 The 100-kDa 2',5'-oligoadenylate synthetase catalyzing preferentially the synthesis of dimeric pppA2'p5'A molecules is composed of three homologous domains.
9790745 1998 The human 2',5'-oligoadenylate synthetase locus is composed of three distinct genes clustered on chromosome 12q24.2 encoding the 100-, 69-, and 40-kDa forms.
9346316 1997 69-kDa and 100-kDa isoforms of interferon-induced (2'-5')oligoadenylate synthetase exhibit differential catalytic parameters.
2440675 1987 Identification of 69-kd and 100-kd forms of 2-5A synthetase in interferon-treated human cells by specific monoclonal antibodies.
1708818 1990 Translational regulation by HIV leader RNA, TAT, and interferon-inducible enzymes.