Property Summary

NCBI Gene PubMed Count 98
PubMed Score 77.34
PubTator Score 89.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (27)

Disease log2 FC p
systemic lupus erythematosus 1.500 4.5e-04
hepatocellular carcinoma 1.200 5.8e-03
malignant mesothelioma 5.900 6.2e-09
psoriasis 3.000 1.9e-09
cutaneous lupus erythematosus 3.500 2.4e-05
glioblastoma 1.900 9.3e-03
cystic fibrosis 1.800 2.8e-04
juvenile dermatomyositis 3.088 2.2e-13
Atopic dermatitis 1.800 1.5e-03
tuberculosis 2.300 3.6e-04
intraductal papillary-mucinous carcinoma... 1.900 7.1e-03
intraductal papillary-mucinous neoplasm ... 3.100 6.8e-04
lung cancer -1.700 1.5e-03
pancreatic cancer 2.000 3.3e-06
breast carcinoma 1.400 2.8e-18
Multiple Sclerosis 2.000 1.7e-02
pediatric high grade glioma 1.700 1.1e-03
pilocytic astrocytoma 1.800 4.1e-07
posterior fossa group B ependymoma 1.300 2.1e-03
primary Sjogren syndrome 1.300 3.4e-02
subependymal giant cell astrocytoma 1.608 3.6e-02
invasive ductal carcinoma 1.800 1.0e-02
lung adenocarcinoma 1.301 1.9e-03
lung carcinoma -1.100 1.1e-07
Breast cancer 1.500 1.0e-04
ovarian cancer 1.200 3.4e-02
chronic rhinosinusitis 1.066 5.0e-02

Gene RIF (69)

PMID Text
26643049 ELF-1 binds an important duplicated GGAA cis-acting element at the OAS1 promoter and in cooperation with RB1 and SP1 recruitment contributes to regulation in response to IFN stimulation.
26516113 Knockdown of OAS1 rescues Lipopolysaccharide-induced cell death and thus may be a promising therapeutic strategy for orthopedic diseases.
26505957 The multivariate analysis showed that the OAS1 GA and AA genotypes were independent factors associated with liver fibrosis progression (p = 0.009, odds ratio [OR] 3.467, 95% confidence interval [CI] 1.273-7.584).
26412166 No association is identified between OAS1 SNP and susceptibility to spontaneous preterm birth (SPTB) and preterm premature rupture of membranes (PPROM).
26398832 Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients.
26063222 While both OAS1-p42 and p46 showed antiviral activity against Dengue irus 2, only OAS1-p42 presented anti-Dengue irus 1 activity.
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
25550087 along with TLR3, functions as a virus recognition receptor on mast cells activating the latent form of RNase L, leading to viral RNA degradation
25477390 The findings represent discovery of a novel signature for OAS1 activation, the 3'-single-stranded pyrimidine (3'-ssPy) motif, with potential functional implications for OAS1 activity in its antiviral and other anti-proliferative roles.
25205466 The OAS1 p46 isoform localizes to the mitochondria.
25059424 our research shows that the OAS1 rs10774671 SNP is associated with CA16 susceptibility and is correlated with mild and severe HFMD.
24905202 The IFNs inhibit viral infections in part through the 2',5'-oligoadenylate (2-5A) synthetase (OAS)/RNase L pathway.
24742347 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
24162774 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
23575436 Newly implicated variants (MYL2, C12orf51 and OAS1) were found to be significantly associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes.
23529855 protein expression is inhibited by hepatitis C virus
23337612 The results suggest that OAS1-OAS3-OAS2 haplotypes are associated with differential susceptibility to clinical outcomes of dengue infection.
23319625 Data show that oligoadenylate synthetase 1 (hOAS1) undergoes more than 20,000-fold activation upon double-stranded RNA (dsRNA) binding.
23220500 Findings provide insights into the potential role of OAS1 polymorphisms in respiratory infection.
23196181 among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV
23011799 Data show that transfection of ORMDL3 in bronchial epithelial cells induced expression of MMP-9, ADAM-8, CCL-20, IL-8, CXCL-10, CXCL-11, oligoadenylate synthetases (OAS) genes, and selectively activated activating transcription factor 6 (ATF6).
22710942 These results identify OAS1 single nucleotide polymorphism rs2660, rs10774671, and rs3741981 as genetic risk factors for chronic hepatitis C.
22709583 Taken together, these data suggest a plausible strategy whereby the adenovirus produces a single RNA transcript capable of inhibiting a variety of members of the innate immune response, including OAS1.
21935451 A single SNP in OAS1 (OR 9.79, p = 0.003) was associated with increased risk for West Nile encephalitis and paralysis (WNE/P).
21735172 Polymorphisms in OAS1 is associated with multiple sclerosis.
21638280 The OAS1 SNP rs2660 AA genotype was associated significantly with prostate cancer, whereas the GG genotype protected against prostate cancer.
21450824 The authors report that expression of human herpesvirus 5 ORF94 protein leads to decreased 2',5'-oligoadenylate synthetase (OAS) expression in transfected cells with and without interferon stimulation.
21182542 Show a significant association between the functional SNP at exon 7 SAS of OAS1 gene and the viral response to interferon in chronic hepatitis c patients.
21050126 Observational study of gene-disease association. (HuGE Navigator)
20679634 A functional OAS1 single nucleotide polymorphism, AA genotype, confers susceptibility to MS and the GG genotype may protect against increased disease activity.
20679634 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20309637 These findings indicate that the expression of MxA, 2',5'-OAS and PKR are up-regulate by PI3K-AKT signal pathway, and Raf-MEK-ERK signal pathway has a negative regulatory effect on the expression of MxA and no significant effect on 2',5'-OAS and PKR.
20079393 association between gene haplotypes and rubella virus-specific cytokine secretion in children immunized with rubella vaccine
19956105 OAS1 data suggest that there may be a weak association with type I diabetes for two OAS1 polymorphisms, rs3741981 and rs10774671, in populations of European descent.
19799013 SNP rs10774671 of OAS-1 gene benefits patients with chronic HBV infection to achieve spontaneous HBeAg seroconversion.
19665006 mechanism of 2'-5'-oligoadenylate synthetase activation by double stranded RNA was studied.
19575500 Data show that the hepatitis C virus core protein specifically and effectively activates the 2'-5'oligoadenylate synthetase gene promoter.
19559055 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19515215 The SNP of OAS-1 at the exon 3 of its coding sequence was associated with progression of disease in Japanese patients with HCV infection.
19515215 Observational study of gene-disease association. (HuGE Navigator)
19462904 The expression levels of both MX1 and OAS1 in systemic lupus erythematosus patients are up-regulated, and he expression levels of OAS1 genes are associated with SLE disease activity.
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19247438 Data identifies OAS1 single nucleotide polymorphism rs10774671 as a host genetic risk factor for initial infection with West Nile Virus in humans.
19247438 Observational study of gene-disease association. (HuGE Navigator)
19203244 The pronounced difference in gene regulation between the OAS1 gene agrees with a functional difference between these genes, which must exist as a consequence of the lack of the 2-5A synthetase activity of the OASL protein.
17963609 2'-5' oligoadenylate synthetase 1 gene polymorphism in associated with hepatitis B susceptibility.
17092260 Observational study of gene-disease association. (HuGE Navigator)
17092260 findings indicate that the OAS1 gene polymorphisms may confer susceptibility to multiple sclerosis or serve as markers of functional variants and suggest that OAS1 activity is involved in the etiology of the disease
16824203 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16824203 Polymorphisms within the OAS1 gene are associated with susceptibility to severe acute respiratory syndrome.
16644715 Observational study of gene-disease association. (HuGE Navigator)
16644715 No evidence of association with either type 1 diabetic affcted or unaffected siblings in terms of relative risk.
16235172 single nucleotide polymorphisms (SNPs) identified in OAS exons in hospitalized patients with West Nile Virus infection
16014697 Observational study of gene-disease association. (HuGE Navigator)
15865429 Naturally mutated residues Lys404, Pro500 and Ser471 of E17 isozyme of 2',5'-oligoadenylate synthetase from a transgenic mouse serve an essential function in maintaining the enzyme activity of the protein.
15855350 OAS1 single nucleotide polymorphisms were significantly increased in diabetic compared with healthy siblings.
15850793 IL-28A and IL-29 induced mRNA expression of the antiviral proteins 2',5'-OAS and MxA was abolished by overexpression of SOCS-1
15766558 Observational study of gene-disease association. (HuGE Navigator)
15766558 polymorphisms of two interferon-inducible genes OAS-1 and myxovirus resistance-A might affect susceptibility to the disease and progression of severe acute respiratory syndrome at each level
15732009 This genetic polymorphism makes OAS1 an excellent candidate for a human gene that influences host susceptibility to viral infection.
12944978 Observational study of gene-disease association. (HuGE Navigator)
12944978 Polymorphisms in the OSA1 gene is associated with outcome of hepatitis C virus infection
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
12082089 sequence motifs in OAS1 regulate polyadenylation
11986302 identification of the substrate-binding sites
11980899 role in interferon-gamma inhibition of respiratory syncytial virus infection of human epithelial cells
1708818 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTL      1 - 70
RGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ     71 - 140
LGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIR    141 - 210
LVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKN    211 - 280
PIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESN    281 - 350
SADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL                        351 - 400
//

Text Mined References (99)

PMID Year Title
26643049 2015 The hematopoietic regulator, ELF-1, enhances the transcriptional response to Interferon-? of the OAS1 anti-viral gene.
26516113 2015 Low expression of microRNA-21 contributes to LPS-induced osteoblast cell apoptosis through up-regulation of OAS1.
26505957 2015 Impact of OAS1 Exon 7 rs10774671 Genetic Variation on Liver Fibrosis Progression in Egyptian HCV Genotype 4 Patients.
26412166 2015 [A case-control study on association between OAS1 polymorphism and susceptibility to spontaneous preterm birth and preterm premature rupture of membranes].
26398832 2016 Association of Oligoadenylate Synthetase Gene Cluster and DC-SIGN (CD209) Gene Polymorphisms with Clinical Symptoms in Chikungunya Virus Infection.
26063222 2015 High Anti-Dengue Virus Activity of the OAS Gene Family Is Associated With Increased Severity of Dengue.
25550087 2015 Roles of retinoic acid-inducible gene-I-like receptors (RLRs), Toll-like receptor (TLR) 3 and 2'-5' oligoadenylate synthetase as viral recognition receptors on human mast cells in response to viral infection.
25477390 2015 A novel RNA molecular signature for activation of 2'-5' oligoadenylate synthetase-1.
25416956 2014 A proteome-scale map of the human interactome network.
25205466 2014 Mitochondrial localization of the OAS1 p46 isoform associated with a common single nucleotide polymorphism.
25059424 2014 Association analysis of polymorphisms in OAS1 with susceptibility and severity of hand, foot and mouth disease.
24905202 2014 Viral phosphodiesterases that antagonize double-stranded RNA signaling to RNase L by degrading 2-5A.
23575436 2013 New susceptibility loci in MYL2, C12orf51 and OAS1 associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes in the Korean population.
23529855 2014 Hepatitis C virus impairs TLR3 signaling and inhibits IFN-? 1 expression in human hepatoma cell line.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23337612 2013 Polymorphisms in the oligoadenylate synthetase gene cluster and its association with clinical outcomes of dengue virus infection.
23319625 2013 Structural basis for cytosolic double-stranded RNA surveillance by human oligoadenylate synthetase 1.
23220500 2013 Differential effects of a common splice site polymorphism on the generation of OAS1 variants in human bronchial epithelial cells.
23196181 2013 The ribonuclease L-dependent antiviral roles of human 2',5'-oligoadenylate synthetase family members against hepatitis C virus.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23011799 2012 ORMDL3 is an inducible lung epithelial gene regulating metalloproteases, chemokines, OAS, and ATF6.
22710942 2013 Evaluate the relationship between polymorphisms of OAS1 gene and susceptibility to chronic hepatitis C with high resolution melting analysis.
22709583 2012 Regulation of the interferon-inducible 2'-5'-oligoadenylate synthetases by adenovirus VA(I) RNA.
21939710 2011 Genetic polymorphisms in host antiviral genes: associations with humoral and cellular immunity to measles vaccine.
21935451 2011 Host genetic risk factors for West Nile virus infection and disease progression.
21735172 2012 Identification of a new susceptibility variant for multiple sclerosis in OAS1 by population genetics analysis.
21638280 2011 2'-5' oligoadenylate synthetase 1 polymorphism is associated with prostate cancer.
21450824 2011 Inhibition of 2',5'-oligoadenylate synthetase expression and function by the human cytomegalovirus ORF94 gene product.
21269460 2011 Initial characterization of the human central proteome.
21182542 2011 Single nucleotide polymorphism at exon 7 splice acceptor site of OAS1 gene determines response of hepatitis C virus patients to interferon therapy.
21142819 2011 The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.
21050126 2010 Variability in the 2'-5'-oligoadenylate synthetase gene cluster is associated with human predisposition to tick-borne encephalitis virus-induced disease.
20679634 2010 OAS1: a multiple sclerosis susceptibility gene that influences disease severity.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20309637 2011 IL-29 and IFN-? regulate the expression of MxA, 2',5'-OAS and PKR genes in association with the activation of Raf-MEK-ERK and PI3K-AKT signal pathways in HepG2.2.15 cells.
20079393 2010 2'-5'-Oligoadenylate synthetase single-nucleotide polymorphisms and haplotypes are associated with variations in immune responses to rubella vaccine.
19956105 2009 Reassessment of the type I diabetes association of the OAS1 locus.
19923450 2009 Distinct antiviral roles for human 2',5'-oligoadenylate synthetase family members against dengue virus infection.
19904482 2009 Evolution of the 2'-5'-oligoadenylate synthetase family in eukaryotes and bacteria.
19799013 2009 [Relationship between SNP rs10774671 on OAS-1 gene and spontaneous HBeAg seroconversion in chronic HBV infection].
19665006 2009 2'-5'-Oligoadenylate synthetase is activated by a specific RNA sequence motif.
19575500 2009 Specific activation of 2'-5'oligoadenylate synthetase gene promoter by hepatitis C virus-core protein: a potential for developing hepatitis C virus targeting gene therapy.
19559055 2009 A pharmacogenetic study of polymorphisms in interferon pathway genes and response to interferon-alpha treatment in chronic hepatitis B patients.
19515215 2009 Polymorphism of OAS-1 determines liver fibrosis progression in hepatitis C by reduced ability to inhibit viral replication.
19462904 2009 [The correlation of myxovirus resistance 1 and 2'5'-ollgoadenylate synthetase 1 with clinical features of systemic lupus erythematosus].
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19247438 2009 Genetic variation in OAS1 is a risk factor for initial infection with West Nile virus in man.
19203244 2009 Differential regulation of the OASL and OAS1 genes in response to viral infections.
18931074 2008 The p59 oligoadenylate synthetase-like protein possesses antiviral activity that requires the C-terminal ubiquitin-like domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17963609 2007 [Association of polymorphism of 2'-5' oligoadenylate synthetase 1 gene with the susceptibility of hepatitis B virus infection and IFN-alpha treatment response].
17408844 The human 2'-5'oligoadenylate synthetase family: unique interferon-inducible enzymes catalyzing 2'-5' instead of 3'-5' phosphodiester bond formation.
17092260 2006 OAS1 gene haplotype confers susceptibility to multiple sclerosis.
17024523 2006 The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla.
16824203 2006 Association of SARS susceptibility with single nucleic acid polymorphisms of OAS1 and MxA genes: a case-control study.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16644715 2006 No evidence for association of OAS1 with type 1 diabetes in unaffected siblings or type 1 diabetic cases.
16541075 2006 The finished DNA sequence of human chromosome 12.
16235172 2005 Single nucleotide polymorphisms in genes for 2'-5'-oligoadenylate synthetase and RNase L inpatients hospitalized with West Nile virus infection.
16014697 2006 Type 1 diabetes and the OAS gene cluster: association with splicing polymorphism or haplotype?
15865429 2005 Natural mutations in a 2'-5' oligoadenylate synthetase transgene revealed residues essential for enzyme activity.
15855350 2005 OAS1 splice site polymorphism controlling antiviral enzyme activity influences susceptibility to type 1 diabetes.
15850793 2005 SOCS-1 inhibits expression of the antiviral proteins 2',5'-OAS and MxA induced by the novel interferon-lambdas IL-28A and IL-29.
15766558 2005 Polymorphisms of interferon-inducible genes OAS-1 and MxA associated with SARS in the Vietnamese population.
15732009 2005 Variation in antiviral 2',5'-oligoadenylate synthetase (2'5'AS) enzyme activity is controlled by a single-nucleotide polymorphism at a splice-acceptor site in the OAS1 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15039538 2004 Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12944978 2003 Polymorphisms in interferon-induced genes and the outcome of hepatitis C virus infection: roles of MxA, OAS-1 and PKR.
12799444 2003 Characterization of the 2'-5'-oligoadenylate synthetase ubiquitin-like family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
12082089 2002 The cleavage/polyadenylation activity triggered by a U-rich motif sequence is differently required depending on the poly(A) site location at either the first or last 3'-terminal exon of the 2'-5' oligo(A) synthetase gene.
11986302 2002 Identification of the substrate-binding sites of 2'-5'-oligoadenylate synthetase.
11980899 2002 2'-5' Oligoadenylate synthetase plays a critical role in interferon-gamma inhibition of respiratory syncytial virus infection of human epithelial cells.
11682059 2001 Inhibition of 2'-5' oligoadenylate synthetase by divalent metal ions.
11323417 2001 A specific isozyme of 2'-5' oligoadenylate synthetase is a dual function proapoptotic protein of the Bcl-2 family.
11092454 2000 Gene structure and function of the 2'-5'-oligoadenylate synthetase family.
10464285 1999 The nature of the catalytic domain of 2'-5'-oligoadenylate synthetases.
9790745 1998 The human 2',5'-oligoadenylate synthetase locus is composed of three distinct genes clustered on chromosome 12q24.2 encoding the 100-, 69-, and 40-kDa forms.
9407111 1997 Enzymatic activity of 2'-5'-oligoadenylate synthetase is impaired by specific mutations that affect oligomerization of the protein.
9344649 1997 A sequence-ready physical map of a region of 12q24.1.
9325053 1997 A high-resolution PAC and BAC map of the SCA2 region.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6348777 1983 Molecular cloning and sequence of partial cDNA for interferon-induced (2'-5')oligo(A) synthetase mRNA from human cells.
3754863 1986 Structure and expression of a cloned cDNA for human (2'-5')oligoadenylate synthetase.
3753689 1986 Full-length sequence and expression of the 42 kDa 2-5A synthetase induced by human interferon.
3175763 1988 Cloning and chromosomal location of human genes inducible by type I interferon.
3121313 1987 New inducers revealed by the promoter sequence analysis of two interferon-activated human genes.
2830497 1987 Interferon-responsive regulatory elements in the promoter of the human 2',5'-oligo(A) synthetase gene.
2573556 1989 Association of IDDM and attenuated response of 2',5'-oligoadenylate synthetase to yellow fever vaccine.
2456211 1988 Interferon-induced binding of nuclear factors to promoter elements of the 2-5A synthetase gene.
2440675 1987 Identification of 69-kd and 100-kd forms of 2-5A synthetase in interferon-treated human cells by specific monoclonal antibodies.
2426799 1986 Interferon-regulated human 2-5A synthetase gene maps to chromosome 12.
2416561 1985 Structure of two forms of the interferon-induced (2'-5') oligo A synthetase of human cells based on cDNAs and gene sequences.
2411547 1985 Human 2-5A synthetase: characterization of a novel cDNA and corresponding gene structure.
1708818 1990 Translational regulation by HIV leader RNA, TAT, and interferon-inducible enzymes.
1651324 1991 Cloning, sequencing, and expression of two murine 2'-5'-oligoadenylate synthetases. Structure-function relationships.