Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.04
PubTator Score 5.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.3e-03
lung cancer 4740 1.4e-02
osteosarcoma 7950 1.7e-02
Breast cancer 3578 4.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.700 4.3e-02
lung cancer 1.100 1.4e-02
osteosarcoma -1.026 1.7e-02
ovarian cancer -1.500 4.3e-03

Gene RIF (3)

AA Sequence

MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAV      1 - 70
LKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVF     71 - 140
EATDIKITVYTL                                                              141 - 152
//

Text Mined References (12)

PMID Year Title