Property Summary

NCBI Gene PubMed Count 3
PubMed Score 56.66
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86UD1
Symbols NS5ATP13TP2

Gene

OAF

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVS      1 - 70
FTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHL     71 - 140
HMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDH    141 - 210
GKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG           211 - 273
//

Text Mined References (4)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.