Property Summary

NCBI Gene PubMed Count 3
PubMed Score 60.56
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVS      1 - 70
FTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHL     71 - 140
HMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDH    141 - 210
GKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG           211 - 273
//

Text Mined References (4)

PMID Year Title