Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.75
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ulcerative colitis 2,087 2.0

Gene RIF (5)

PMID Text
20718936 Improved genotyping of the human minor histocompatibility antigen HB-1 by polymerase chain reaction with sequence-specific primers using a complementary oligonucleotide.
20353833 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18093280 Observational study of gene-disease association. (HuGE Navigator)
9892612 The paper described that non-AUG (CTG) translation initiation codon at nucleotide positions 108-110 was used for the encoded protein.

AA Sequence

MEEQPECREEKRGSLHVWKSELVEVEDDVYLRHSSSLTYRL                                   1 - 41
//

Text Mined References (10)

PMID Year Title
20718936 2010 Improved genotyping of the human minor histocompatibility antigen HB-1 by polymerase chain reaction with sequence-specific primers using a complementary oligonucleotide.
20353833 2010 Degree of predicted minor histocompatibility antigen mismatch correlates with poorer clinical outcomes in nonmyeloablative allogeneic hematopoietic cell transplantation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18093280 2008 Role of minor histocompatibility antigens in renal transplantation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15102363 2004 Minor histocompatibility antigens--big in tumour therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12355426 2002 Bi-directional allelic recognition of the human minor histocompatibility antigen HB-1 by cytotoxic T lymphocytes.
9892612 1999 A human minor histocompatibility antigen specific for B cell acute lymphoblastic leukemia.
8992968 1997 Recognition of a B cell leukemia-associated minor histocompatibility antigen by CTL.