Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.75
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-07
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 2.3

Gene RIF (5)

AA Sequence

MEEQPECREEKRGSLHVWKSELVEVEDDVYLRHSSSLTYRL                                   1 - 41
//

Text Mined References (10)

PMID Year Title