Property Summary

NCBI Gene PubMed Count 23
PubMed Score 207.62
PubTator Score 29.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Molybdenum Cofactor Deficiency, Complementation Group B 2 0.0 0.0

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-02
atypical teratoid / rhabdoid tumor -2.000 8.1e-05
glioblastoma -1.700 3.0e-04
group 3 medulloblastoma -1.700 2.2e-05
hereditary spastic paraplegia -1.232 4.2e-03
medulloblastoma, large-cell -2.300 3.0e-05
pancreatic ductal adenocarcinoma liver m... -1.753 1.2e-03
Pick disease -1.100 8.6e-05
psoriasis -1.600 7.2e-05
tuberculosis and treatment for 6 months 1.100 1.9e-04

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQL      1 - 70
LVLQPGDEIAVIPPISGG                                                         71 - 88
//

Text Mined References (28)

PMID Year Title