Property Summary

NCBI Gene PubMed Count 13
PubMed Score 33.28
PubTator Score 17.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (10)

AA Sequence

MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNQEACSGPGAP      1 - 70
PFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPVWGSQGSDLASESAAQGDILQ     71 - 140
AAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYVNVPELVSELVLRGGRWGQWERSTEPQREAE    141 - 210
QEGGQVLHSEEVPLLYLGRVHWRVNPSRTPGGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKV    211 - 280
ASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSD    281 - 350
GERTAPFCSWFQGVLGILRCRAIAWLQS                                              351 - 378
//

Text Mined References (13)

PMID Year Title