Property Summary

NCBI Gene PubMed Count 35
Grant Count 27
R01 Count 18
Funding $1,440,540.01
PubMed Score 50.27
PubTator Score 51.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26818545 miR-26a regulated mouse hepatocyte proliferation by directly targeting the 3' untranslated regions of cyclin D2/cyclin E2.
26600399 Survivin and cyclin E2 genes expression may have clinical relevance and can be considered as molecular risk factors for AL. Also they may be useful as predictive markers for treatment outcome in leukemic patients.
26265440 In breast cancer patients, high levels of HMGA1 and CCNE2 expression are associated with the YAP/TAZ signature.
26057453 miR-144-5p functions as tumour suppressor in BC cells. CCNE1 and CCNE2 were directly regulated by miR-144-5p and might be good prognostic markers for survival of bladder cancer patients
25843294 Results suggest that the miR-30d-5p/CCNE2 axis may contribute to NSCLC cell proliferation and motility.
25550809 Our study shows miR-25 is overexpressed in small cell lung cancer and acting as oncogenic regulator by regulating cyclin E2.
25475054 data suggests the potential role of monomorphic morphology, high cyclin E2 and Ki67 expression as adverse prognostic factors for TNKLPD
24116110 Data indicate that miR-26a overexpression inhibited pancreatic cancer cell growth by the downregulation of cyclin E2 expression.
23324395 Cyclin E2 induction of genomic instability by a mechanism distinct from cyclin E1 indicates that these two proteins have unique functions in a cancer setting.
23324394 In cancer cells Fbw7, fails to effectively target cyclin E2 for proteosomal degradation.
More...

AA Sequence

MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCI      1 - 70
IIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQ     71 - 140
MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEF    141 - 210
AYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLD    211 - 280
LCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIP    281 - 350
MEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH                    351 - 404
//

Text Mined References (40)

PMID Year Title
26818545 2016 miR-26a regulates mouse hepatocyte proliferation via directly targeting the 3' untranslated region of CCND2 and CCNE2.
26600399 2016 Survivin and cyclin E2 genes expression in a cohort of Egyptian acute leukemia patients: Clinical importance and future prospects.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26265440 2015 A novel HMGA1-CCNE2-YAP axis regulates breast cancer aggressiveness.
26057453 2015 Tumour-suppressive microRNA-144-5p directly targets CCNE1/2 as potential prognostic markers in bladder cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25843294 2015 MicroRNA-30d-5p inhibits tumour cell proliferation and motility by directly targeting CCNE2 in non-small cell lung cancer.
25550809 2014 MicroRNA-25 regulates small cell lung cancer cell development and cell cycle through cyclin E2.
25475054 2014 Prognostic implication of morphology, cyclinE2 and proliferation in EBV-associated T/NK lymphoproliferative disease in non-immunocompromised hosts.
24116110 2013 The loss of miR-26a-mediated post-transcriptional regulation of cyclin E2 in pancreatic cancer cell proliferation and decreased patient survival.
More...