Property Summary

NCBI Gene PubMed Count 39
PubMed Score 53.85
PubTator Score 51.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Endometriosis 1.529 4.7e-02
malignant mesothelioma 1.700 2.7e-05
active Crohn's disease 1.029 4.3e-02
adrenocortical carcinoma 1.527 3.1e-03
Atopic dermatitis 1.200 9.4e-04
atypical teratoid / rhabdoid tumor 1.200 1.6e-03
Breast cancer 3.700 2.4e-02
breast carcinoma 2.000 4.0e-44
ductal carcinoma in situ 2.700 7.2e-04
glioblastoma 1.500 4.8e-04
group 3 medulloblastoma 1.800 3.8e-02
intraductal papillary-mucinous carcinoma... 1.500 4.5e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.1e-03
invasive ductal carcinoma 3.600 2.9e-05
lung adenocarcinoma 1.281 1.2e-02
lung cancer 1.400 8.3e-04
medulloblastoma, large-cell 2.000 7.1e-03
nasopharyngeal carcinoma 2.000 7.2e-07
non-small cell lung cancer 2.064 2.3e-22
ovarian cancer 1.800 3.3e-04
pediatric high grade glioma 1.400 1.0e-02
Pick disease -1.100 2.3e-02
primitive neuroectodermal tumor 1.900 4.3e-03
progressive supranuclear palsy -1.500 2.2e-02
psoriasis 1.300 5.4e-26
subependymal giant cell astrocytoma -1.404 3.2e-02

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCI      1 - 70
IIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQ     71 - 140
MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEF    141 - 210
AYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLD    211 - 280
LCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIP    281 - 350
MEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH                    351 - 404
//

Text Mined References (44)

PMID Year Title