Property Summary

NCBI Gene PubMed Count 44
PubMed Score 24.05
PubTator Score 22.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 3.73221314354321E-25
non-small cell lung cancer 2798 4.37275825443243E-22
oligodendroglioma 2849 4.8216507433274E-16
posterior fossa group A ependymoma 1511 1.68422208325453E-12
atypical teratoid / rhabdoid tumor 4369 4.98991892531199E-10
pediatric high grade glioma 2712 1.61866956793733E-8
sonic hedgehog group medulloblastoma 1482 7.90728656710385E-8
glioblastoma 5572 1.72978072015427E-7
primitive neuroectodermal tumor 3031 5.99480687774994E-7
medulloblastoma, large-cell 6234 1.04882393597916E-6
pilocytic astrocytoma 3086 3.20151809562184E-6
hepatocellular carcinoma 550 7.45986109206044E-6
Breast cancer 3099 9.03997489229033E-5
malignant mesothelioma 3163 2.0464901442819E-4
lung adenocarcinoma 2714 2.28255192816479E-4
psoriasis 6685 8.41112878319588E-4
lung cancer 4473 0.00119545415932516
gastric cancer 436 0.00145334576875607
ovarian cancer 8492 0.0204834808244206
acute myeloid leukemia 785 0.0293472998933907
osteosarcoma 7933 0.0381512980579838
Disease Target Count Z-score Confidence
spina bifida 1064 3.182 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.100 0.001
hepatocellular carcinoma 1.300 0.000
malignant mesothelioma 1.400 0.000
psoriasis 1.600 0.001
astrocytoma 1.800 0.000
glioblastoma 2.500 0.000
oligodendroglioma 1.800 0.000
osteosarcoma 1.055 0.038
posterior fossa group A ependymoma 2.200 0.000
sonic hedgehog group medulloblastoma 2.900 0.000
atypical teratoid / rhabdoid tumor 2.600 0.000
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 2.500 0.000
non-small cell lung cancer 1.624 0.000
lung cancer 2.000 0.001
pediatric high grade glioma 2.400 0.000
pilocytic astrocytoma 1.600 0.000
lung adenocarcinoma 1.101 0.000
acute myeloid leukemia -2.100 0.029
ovarian cancer 1.200 0.020
Breast cancer 1.100 0.000

Synonym

Accession O96019 B3KMN1 D3DNR9 Q8TAE5 Q9BVS8 Q9H0W6
Symbols Arp4
ACTL6
BAF53A
INO80K
ARPN-BETA

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (11)

PMID Text
26698646 ACTL6A protein expression predicts poor prognosis of hepatocellular carcinoma and metastasis.
26242195 BAF53 is prerequisite for maintaining the structural integrity of chromosomal subdomains.
23728344 These results indicate that failure to downregulate the BAF53a subunit may contribute to the pathogenesis of rhabdomyosarcoma, and suggest that BAF53a may represent a novel therapeutic target for this tumor.
23395444 Data show that ACTL6a prevents SWI/SNF complex binding to promoters of KLF4 and other differentiation genes and that SWI/SNF catalytic subunits are required for full induction of KLF4 targets.
22573825 The beta-actin-Arp4 complex formation might be a crucial feature in some chromatin-modifying enzyme complexes, such as the Brg1 complex.
21821000 These results suggest that activated expression of the E6 and E7 genes of integrated HPV is dependent on BAF53-dependent higher-order chromatin structure or nuclear motor activity.
21699904 study finds Baf53 and Baf170 are highly regulated in HIV-1-infected cells;innate function of Baf53-containing complexes appears to be transcriptionally suppressive
21699904 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
19716452 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
19454010 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
More...

AA Sequence

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYI      1 - 70
DTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELM     71 - 140
FEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELF    141 - 210
QEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAA    211 - 280
QMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIV    281 - 350
AGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG    351 - 420
KQCVERKCP                                                                 421 - 429
//

Text Mined References (51)

PMID Year Title
26698646 2016 Actin-like 6A predicts poor prognosis of hepatocellular carcinoma and promotes metastasis and epithelial-mesenchymal transition.
26242195 2015 The Actin-Related Protein BAF53 Is Essential for Chromosomal Subdomain Integrity.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23728344 2014 Failure to downregulate the BAF53a subunit of the SWI/SNF chromatin remodeling complex contributes to the differentiation block in rhabdomyosarcoma.
23395444 2013 ACTL6a enforces the epidermal progenitor state by suppressing SWI/SNF-dependent induction of KLF4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22573825 2012 Heterocomplex formation by Arp4 and ?-actin is involved in the integrity of the Brg1 chromatin remodeling complex.
21821000 2011 Suppression of HPV E6 and E7 expression by BAF53 depletion in cervical cancer cells.
21699904 2011 Varying modulation of HIV-1 LTR activity by Baf complexes.
More...