Property Summary

NCBI Gene PubMed Count 48
PubMed Score 28.32
PubTator Score 22.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -2.100 2.9e-02
adult high grade glioma 2.300 5.2e-06
astrocytoma 1.800 3.7e-25
Astrocytoma, Pilocytic 1.500 2.4e-06
atypical teratoid / rhabdoid tumor 2.600 5.0e-10
Breast cancer 1.100 9.0e-05
ependymoma 2.100 9.1e-13
gastric cancer 1.100 1.5e-03
glioblastoma 2.300 3.7e-13
group 3 medulloblastoma 2.000 1.7e-03
hepatocellular carcinoma 1.300 7.5e-06
lung adenocarcinoma 1.101 2.3e-04
lung cancer 2.000 1.2e-03
malignant mesothelioma 1.400 2.0e-04
medulloblastoma, large-cell 3.000 1.0e-06
non-small cell lung cancer 1.624 4.4e-22
oligodendroglioma 1.800 4.8e-16
osteosarcoma 1.055 3.8e-02
ovarian cancer 1.200 2.0e-02
primitive neuroectodermal tumor 2.500 6.0e-07
psoriasis 1.600 8.4e-04

Gene RIF (13)

AA Sequence

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYI      1 - 70
DTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELM     71 - 140
FEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELF    141 - 210
QEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAA    211 - 280
QMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIV    281 - 350
AGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG    351 - 420
KQCVERKCP                                                                 421 - 429
//

Text Mined References (58)

PMID Year Title